Protein Info for BPHYT_RS26920 in Burkholderia phytofirmans PsJN

Annotation: major facilitator transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 583 transmembrane" amino acids 45 to 68 (24 residues), see Phobius details amino acids 80 to 100 (21 residues), see Phobius details amino acids 112 to 138 (27 residues), see Phobius details amino acids 144 to 162 (19 residues), see Phobius details amino acids 173 to 192 (20 residues), see Phobius details amino acids 198 to 220 (23 residues), see Phobius details amino acids 250 to 270 (21 residues), see Phobius details amino acids 277 to 295 (19 residues), see Phobius details amino acids 315 to 337 (23 residues), see Phobius details amino acids 346 to 367 (22 residues), see Phobius details amino acids 379 to 400 (22 residues), see Phobius details amino acids 408 to 435 (28 residues), see Phobius details amino acids 448 to 468 (21 residues), see Phobius details amino acids 553 to 577 (25 residues), see Phobius details TIGR00711: drug resistance MFS transporter, drug:H+ antiporter-2 (14 Spanner) (DHA2) family" amino acids 47 to 492 (446 residues), 245 bits, see alignment E=7.6e-77 PF07690: MFS_1" amino acids 51 to 457 (407 residues), 163.7 bits, see alignment E=3e-52

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_5418)

Predicted SEED Role

"FIG00468057: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TBX8 at UniProt or InterPro

Protein Sequence (583 amino acids)

>BPHYT_RS26920 major facilitator transporter (Burkholderia phytofirmans PsJN)
MADPHAPALERRSSSVLPAQASPCDALVIRAQPLSSVHPCRRKKLALAATILGSSMAFID
GSVVNVALPSIQSELGASVAAIQWVVDAYLLFLGALVLVGGSLGDKLGRRTVFIAGIGLF
TLASIGCGLAPGAAALIAARAVQGVGAALLVPSSLSIIGAVFDDKERGQAIGTWAGVGAI
TSALGPVAGGWLVDAFSWPAIFFLNVPIACATVALAVMAVPDSRQDDEGNSSTLAGGTTG
HAAARLDWPGAATATAGLAALTYGLTLASARGFGNRWVLASILGGLLVLIAFVALEARTR
NPMMPLDVFRSRDFVGANLVTLLLYFGLGGALFFLPFTLIRAYGYSATQAGAALLPVPVT
IGLLSRFTGGLTSRYGARALLTAGPVVAAAGFAMLALPWVRGDYWRGFLPALTVLGLGMT
VTVAPLTTTVMTSVSAARTGVASGINNAVARVASLLAIAVLGIVFVWSHDAALHARLDAL
HVPQAARDAASLAQIGMDTGSASPATGTSASKAKTGAADLTAAHTESDAAPTNVDTARAQ
PEMTRAQADALGAALRAVALVSALCALAGAALAFLTIRSQPPV