Protein Info for BPHYT_RS26900 in Burkholderia phytofirmans PsJN

Annotation: isoprenylcysteine carboxyl methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 transmembrane" amino acids 33 to 51 (19 residues), see Phobius details amino acids 63 to 82 (20 residues), see Phobius details amino acids 88 to 108 (21 residues), see Phobius details amino acids 115 to 135 (21 residues), see Phobius details amino acids 165 to 189 (25 residues), see Phobius details PF06966: DUF1295" amino acids 116 to 218 (103 residues), 29.2 bits, see alignment E=9.5e-11 PF04191: PEMT" amino acids 124 to 207 (84 residues), 28.3 bits, see alignment E=3.2e-10 PF04140: ICMT" amino acids 148 to 206 (59 residues), 32.5 bits, see alignment E=1.4e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_5414)

Predicted SEED Role

"Putative protein-S-isoprenylcysteine methyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TBX4 at UniProt or InterPro

Protein Sequence (228 amino acids)

>BPHYT_RS26900 isoprenylcysteine carboxyl methyltransferase (Burkholderia phytofirmans PsJN)
KKKSGETESVADRVDALPRAITASGMRAASVEVLARCAAALMFSLFAYAAIKRWQQEPNR
ITLLLLVVGAFVTLGLSLFARVPMQRDWTPFAFICAVGGTFYFLAVRLAPGVHLVPEMAG
AALQVFGIFWELFAKASLRRSFGILPANRGVVSRGAYRFVRHPMYLGYFVMDIGFLLVNF
GIQNMIVYGCQFALQVGRILREEKLLSDDESYRAYRSKVRFRVIPGVF