Protein Info for BPHYT_RS26850 in Burkholderia phytofirmans PsJN

Annotation: ATPase AAA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 663 TIGR02329: propionate catabolism operon regulatory protein PrpR" amino acids 15 to 662 (648 residues), 548.6 bits, see alignment E=7.5e-169 PF06506: PrpR_N" amino acids 39 to 204 (166 residues), 137.9 bits, see alignment E=1e-43 PF13188: PAS_8" amino acids 211 to 256 (46 residues), 23.5 bits, see alignment 1.6e-08 PF00158: Sigma54_activat" amino acids 336 to 503 (168 residues), 229 bits, see alignment E=1.1e-71 PF14532: Sigma54_activ_2" amino acids 337 to 508 (172 residues), 71 bits, see alignment E=5e-23 PF07728: AAA_5" amino acids 360 to 479 (120 residues), 27.5 bits, see alignment E=1.1e-09 PF02954: HTH_8" amino acids 634 to 662 (29 residues), 31.8 bits, see alignment (E = 3.8e-11)

Best Hits

KEGG orthology group: K02688, transcriptional regulator, propionate catabolism operon regulatory protein (inferred from 100% identity to bpy:Bphyt_5404)

Predicted SEED Role

"Propionate catabolism operon regulatory protein PrpR" in subsystem Methylcitrate cycle

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TBW4 at UniProt or InterPro

Protein Sequence (663 amino acids)

>BPHYT_RS26850 ATPase AAA (Burkholderia phytofirmans PsJN)
MSTFTSSHTNPDPGRPGIALVSISRLQSLCETVAPRYAGRAKIFSVREGYGAAVTALQAY
VDAGSVDVVLAAGSNGAYLRDNLNVPVVMVKVNGFDVLSAITRATTTWPNAQIGLVLHET
ISHELADLSAWLKVSLKQRAYRSVDEVRLAVDSLAAEGCSVIIGPGMACDFAQQAGLASV
FLYSLGAVEEAFERSVELARVSRQKESKRVRLNTIVAHLRDGVAAFDDAGQVEAVNPAML
DLLGLDREQDVPAQVERAVGPLLRETIEHNLPIEERIEQIGGRALIVNCVPIVEQGVRSG
SVITLQDALVAQRIDRSLRTSQRPKHLVARHQLDDLIGNSAALERVRRLARAGAAHDATV
LLSGESGTGKELVAQGIHNASRRRGNPFVAFNCAALPEGLIESELFGHEEGAFTGARRGG
KPGLFEIAHTGTIFLDEIGEMPAALQSRLLRVLQEREVMKLGSGRATPVDVRVIAATHRD
LHALVEQGAFRADLYFRLNLLQLKLPPLRDRRDDVPQLARYLLSRSALQYGLTEGASERV
LAFLAPLFEHYAWPGNVRELENLLTRAAIYCGDAAGDAGQDWQAMFPEFGRMKAAAATLS
DFGVSGTKNGANGVNAAAEPAPSRISPTRGDVLHALEQAGGNRAAASRALGIGRTTLWRL
LKD