Protein Info for BPHYT_RS26730 in Burkholderia phytofirmans PsJN

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 46 to 65 (20 residues), see Phobius details amino acids 76 to 99 (24 residues), see Phobius details amino acids 185 to 205 (21 residues), see Phobius details amino acids 246 to 273 (28 residues), see Phobius details amino acids 279 to 299 (21 residues), see Phobius details amino acids 306 to 324 (19 residues), see Phobius details amino acids 340 to 369 (30 residues), see Phobius details PF01594: AI-2E_transport" amino acids 32 to 125 (94 residues), 34.4 bits, see alignment E=7.4e-13 amino acids 192 to 366 (175 residues), 114.7 bits, see alignment E=2.6e-37

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_5379)

Predicted SEED Role

"transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TBT6 at UniProt or InterPro

Protein Sequence (650 amino acids)

>BPHYT_RS26730 membrane protein (Burkholderia phytofirmans PsJN)
MKISLPPSGRPNRVYPPGTPSLHGLASVITGVVVVCGLYFGRAVLIPITLSVLLSFLLAP
LVQMLRRFHMGQLPSIFIAVLFALASLLAVGALITAQLVQLAADLPQYQEAIEQKIETVQ
EKTVGRADSLMSRAAVALQRVSPPKPNPPRPTGRAARNAPAVPQPVEVHEPAPTPMQLAQ
RALSPAIAPIETTFIVLVVTIFILLQREDLRDRLISLFGSRDLHRTTTAINDAAVRLSRY
FVAQLGVNLSAGGVIAIGLAIIGVPGALLFGVIAALLRFVPYIGIWIAAILAVFLAAAIQ
PQWTMAVYTLILFIVVDVVAGQIAEPLLYGHRSGLSPLAVVVAAIFWSWLWGPIGLVLST
PLTLCVVTLGRYADRLNFLTVLLGDQPALTPAQNFYQRLLADDPHEAIVQAERLLREMSL
IDYYDKVALEGLKLARNDAMRGVLMPDQLQRINDALVDIVENLEIADGLPDRMARSEPAD
TASALLASASADLSERHDSHIAAHPQLRREAEKTSVLCVPGRGSFDEVTTAIAVQLLSRQ
GLAPMMATHSGYRSARADEPSFKDAPIICIVSLDAPESPPYLRNMLRRTREWRPRATLVV
GVGGAPEGGPEMGATGASHAAPTFRAMIEECLAASSLPHARHASHVGGAD