Protein Info for BPHYT_RS26670 in Burkholderia phytofirmans PsJN

Annotation: Cobalt-precorrin-5B C(1)-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01888: CbiD
  • amino acids 12 to 274 (263 residues), 304.7 bits, E=2.4e-95
• TIGR00312: cobalamin biosynthesis protein CbiD
  • amino acids 19 to 321 (303 residues), 208.9 bits, E=4.9e-66

Best Hits

Swiss-Prot: 100% identical to CBID_PARPJ: Cobalt-precorrin-5B C(1)-methyltransferase (cbiD) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K02188, cobalamin biosynthesis protein CbiD (inferred from 100% identity to bpy:Bphyt_5367)

Predicted SEED Role

"Cobalt-precorrin-6 synthase, anaerobic" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis

MetaCyc Pathways

• adenosylcobalamin biosynthesis I (anaerobic) (30/36 steps found)
• cob(II)yrinate a,c-diamide biosynthesis I (early cobalt insertion) (14/15 steps found)

Sequence Analysis Tools

See B2TBS5 at UniProt or InterPro

Protein Sequence (365 amino acids)

>BPHYT_RS26670 Cobalt-precorrin-5B C(1)-methyltransferase (Burkholderia phytofirmans PsJN)
MREETPEHPAPLRSGYTTGSCATATSLAAARLLLAGVVSEVAEILLPKGQHVPMPLVFCR
LIGNGDEGAEAGTVKDAGDDPDVTHGAVVFARVRLVAEPGVIFRAGPGVGTVTRAGLTLP
VGEPAINPVPRRMMTEHLAELAAEHAYGGGFEVTIGVEGGEALALKTMNPRLGILGGLSI
LGTTGIVRPFSCSAYIASIHQGIDVARANGYTHLAACTGNASEDAMRAHYGLPDIALIEM
GDFVGAVLKHMKRAPVERLSVCGGFGKLSKLAAGHLDLHSRNSSIDLERLAQWAAEQGAD
DALQASIRAANTSQQAVALAHAQQVPLGDIVCRHALAVAREIVPPQVNVEMFAIDRRGLL
IGAAQ