Protein Info for BPHYT_RS26645 in Burkholderia phytofirmans PsJN

Annotation: ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF01547: SBP_bac_1" amino acids 35 to 300 (266 residues), 62.5 bits, see alignment E=1.1e-20 PF13416: SBP_bac_8" amino acids 45 to 318 (274 residues), 107.1 bits, see alignment E=2.2e-34 PF13343: SBP_bac_6" amino acids 77 to 315 (239 residues), 75.7 bits, see alignment E=6e-25

Best Hits

Swiss-Prot: 52% identical to SPUD_PSEAE: Putrescine-binding periplasmic protein SpuD (spuD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K11073, putrescine transport system substrate-binding protein (inferred from 100% identity to bpy:Bphyt_5362)

MetaCyc: 52% identical to putrescine ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-25-RXN [EC: 7.6.2.11, 7.6.2.16]

Predicted SEED Role

"Putrescine ABC transporter putrescine-binding protein PotF (TC 3.A.1.11.2)" in subsystem Polyamine Metabolism (TC 3.A.1.11.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.11 or 7.6.2.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TBR9 at UniProt or InterPro

Protein Sequence (366 amino acids)

>BPHYT_RS26645 ABC transporter substrate-binding protein (Burkholderia phytofirmans PsJN)
MPRNTIKPLLAALLLGAFSAASLADEKQLNLYNWADYIAKDTVPNFEKESGIHVRYDVYD
GDETLQAKLLTGSTGYDVVVPTSNFLAKQIEAGIYQKLDKSKLPNLANLDRNLLKLVADA
DPGNQYAVPWAWGTTGLGYNVTRVKKILGNEAPLDNWDILFKPEYLSKLKSCGVSVLDAP
SDVFAVTLHYLGRDPNSENPADYQAAYDALKKIRPYITQFNATSYINDLAGDDICFALSW
SGDVSMASHRAREAGKSYEVKYFIPEGGAPVWFDMMAIPKDAPHPEAALNWINYIERPEV
HADITNTVFYPNADAAARKFVRPEILNDPTVYPPEPVLKTLFLLKPLPAQIKRLEGRLWA
QLKSGS