Protein Info for BPHYT_RS26620 in Burkholderia phytofirmans PsJN

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 497 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 46 to 65 (20 residues), see Phobius details amino acids 77 to 96 (20 residues), see Phobius details amino acids 102 to 126 (25 residues), see Phobius details amino acids 138 to 158 (21 residues), see Phobius details amino acids 165 to 185 (21 residues), see Phobius details amino acids 197 to 217 (21 residues), see Phobius details amino acids 223 to 242 (20 residues), see Phobius details amino acids 263 to 284 (22 residues), see Phobius details amino acids 296 to 316 (21 residues), see Phobius details amino acids 328 to 347 (20 residues), see Phobius details amino acids 353 to 377 (25 residues), see Phobius details amino acids 398 to 416 (19 residues), see Phobius details amino acids 455 to 478 (24 residues), see Phobius details PF06609: TRI12" amino acids 10 to 171 (162 residues), 28.3 bits, see alignment E=1e-10 PF07690: MFS_1" amino acids 17 to 405 (389 residues), 177.1 bits, see alignment E=7.2e-56 PF00083: Sugar_tr" amino acids 45 to 190 (146 residues), 61.3 bits, see alignment E=1.3e-20 amino acids 294 to 477 (184 residues), 29.5 bits, see alignment E=5.7e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_5357)

Predicted SEED Role

"drug resistance transporter, EmrB/QacA family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TBR4 at UniProt or InterPro

Protein Sequence (497 amino acids)

>BPHYT_RS26620 MFS transporter (Burkholderia phytofirmans PsJN)
MSRNPQSSRPLVIAAVMASMAMVAIEATIVSTAMPQIVAQLGDLHLYSWVFSSFLLTQTA
MTVVFGKLADLYGRKPVMLAGIAIFLLGSVLAGFAWSMPAMIAFRLIQGVGAGAIQPVTL
TIVADLYPARERGKVQGYLASVWAISAVVGPMVGGFIIHNMSWAWIFWMNVPIGLASAAG
FIAFLRESERHARPSIDFGGAALFMAAIASLMMALTYAGDDQIAQASMAGGAFALCVLLF
VWQERRAAEPMISFALWSRRPIAASNGATLLSGMILMGSTTFLPMYVQGVLHRSPVIAGL
ALTMMMVGWPTGATLAAKSFHRLGLRRILIGGSAAIPLGAVLLLFLSPGGSPLVAAFGSL
IMGFGMGTSSVSCLILIQEIVRMDERGSATASNLFSRNLGSTLGATLFGAVLNFGLSHSK
GVAVVTSDQLKALLQNQTASLGDSDMIRTVLHQSLHLTFISLFVIAIFVVVLLMFVPAVK
IGGDRKMPIEALAPLED