Protein Info for BPHYT_RS26400 in Burkholderia phytofirmans PsJN

Annotation: sodium:solute symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 490 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 44 to 59 (16 residues), see Phobius details amino acids 72 to 94 (23 residues), see Phobius details amino acids 116 to 136 (21 residues), see Phobius details amino acids 147 to 172 (26 residues), see Phobius details amino acids 184 to 205 (22 residues), see Phobius details amino acids 233 to 253 (21 residues), see Phobius details amino acids 270 to 291 (22 residues), see Phobius details amino acids 316 to 344 (29 residues), see Phobius details amino acids 365 to 382 (18 residues), see Phobius details amino acids 388 to 409 (22 residues), see Phobius details amino acids 421 to 442 (22 residues), see Phobius details amino acids 457 to 476 (20 residues), see Phobius details PF00474: SSF" amino acids 34 to 428 (395 residues), 84.5 bits, see alignment E=3.6e-28

Best Hits

Swiss-Prot: 66% identical to YHJB_BACSU: Uncharacterized symporter YhjB (yhjB) from Bacillus subtilis (strain 168)

KEGG orthology group: K03307, solute:Na+ symporter, SSS family (inferred from 100% identity to bpy:Bphyt_5313)

Predicted SEED Role

"Acetate permease ActP (cation/acetate symporter)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TBM0 at UniProt or InterPro

Protein Sequence (490 amino acids)

>BPHYT_RS26400 sodium:solute symporter (Burkholderia phytofirmans PsJN)
MSALVIIAAITLFALYLGVRAKRGHDMSLEQWTVGGRSFGTAFVFLLMAGEIYTTFTFLG
GSGFAYGKGAPVYYILAYGTLAYILSYWMLPPIWRYAKNHRLVSQPHFFTRKYDSPALGT
LVALVGVAALIPYLVLQLKGLGIIVATASYGAISSTAAVWIGACVVTAYVIVSGVRGSAW
NSVVKDMLILAIVLFLGIYLPLHYYGGFGDMFRAIDAARPGFLTFPAKGSSVTWFQSTVL
LTALGFFMWPHTFGSIFTAKDERIFRRNAMVLPLYQLILLFVFFVGFAATLKVPGLKGGD
IDLSLFRLSLQTFDPWFVGVIGAAGILTALVPGSMILTSASTLLANDVYRGMVNRNASDA
TVAKLARFLVPVVALVAVGFTLQGGETIVALLLMGYSFVTQLFPAVICSLRPHNRATKQG
AFCGILAGVAVVAVTTTMHLSIGQLMPFLPDALKDINIGFLALAVNIIVFALVSAMTQPR
PVEQTHAPVH