Protein Info for BPHYT_RS26260 in Burkholderia phytofirmans PsJN

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 722 transmembrane" amino acids 29 to 51 (23 residues), see Phobius details amino acids 305 to 327 (23 residues), see Phobius details PF02743: dCache_1" amino acids 89 to 288 (200 residues), 48.8 bits, see alignment E=9.9e-17 PF02518: HATPase_c" amino acids 468 to 584 (117 residues), 63.5 bits, see alignment E=3.7e-21 PF00072: Response_reg" amino acids 610 to 718 (109 residues), 55.5 bits, see alignment E=9e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_5284)

Predicted SEED Role

"FOG: PAS/PAC domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TDD2 at UniProt or InterPro

Protein Sequence (722 amino acids)

>BPHYT_RS26260 histidine kinase (Burkholderia phytofirmans PsJN)
MEIVTVQRAERAAVDFPMPSRNFAATRRMLLIVLAVSIAFPLICLAAYGYFDYQRRIADS
NDMIDRLARVAEEQAVKVMDLNQQMSSRIVELLGNDDDAQIRAREAMLHDRLHGIGGDFP
QVSSIYLLGAKGDLLVSSRTYPAPALSIAQREDFISAKAMRPQPYFSLPMFGPLSQTNVF
TTATGRSDDNGQFLGVVSVALRNEYFSRFYRELTNGDASLALGLYRQDGSLLVRYPPWPA
GAQPSPRSKFTQALRDRQLFGHVRLDSTVDGVERLLAFRRVGDYPLYVMSAYATSSIGKA
WRQHFVMIAALTALPCIAIWLLVFYSLRQLAGERRAWERWQGEVAMRLSAEASSRQLQRM
GALGNLVANVAHDFNNLLMVVSANTELARLKRFNNVEKEVLAVERATASAESLTRRLLSV
ARKQPLKQQPLDLATWLPAAAPLIDAALGDNVELALNMVENVWQVLADPTDLEFAIMNLA
VNARDAMPRGGRFVIRCQNNRLVGSDTLLPDGEYVLIACTDDGEGMPEAVARRAFEPLFT
TKLRGSGTGLGLAQVLSMCEQAGGTARIDSVPGSGTTVRMYLPRYRDRRKTTVVQAETVP
APVPPPSGVVLLVEDNEEVAAGVAAVLETFGCEVRHELTADQALDVLTGGARFELVLSDI
QMPGKLNGIDLAEKVRSAWPSQKIALMTGYADELERARRLGVAILAKPFNIDELHALVAC
EP