Protein Info for BPHYT_RS26240 in Burkholderia phytofirmans PsJN

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 98 transmembrane" amino acids 16 to 34 (19 residues), see Phobius details amino acids 40 to 59 (20 residues), see Phobius details amino acids 65 to 83 (19 residues), see Phobius details PF10947: DUF2628" amino acids 15 to 91 (77 residues), 36.3 bits, see alignment E=3.1e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_5280)

Predicted SEED Role

"FIG00455835: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TDC8 at UniProt or InterPro

Protein Sequence (98 amino acids)

>BPHYT_RS26240 hypothetical protein (Burkholderia phytofirmans PsJN)
MGEKIYLRYPGKDETVAVATGFSWGACLLGFVWALSKKMWFAAFVMLAINLLLFCSGLWG
ETADLIGLVLSVLFGIACGMYGNQWHRWTLEKRGYVVL