Protein Info for BPHYT_RS26230 in Burkholderia phytofirmans PsJN

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 50 to 71 (22 residues), see Phobius details amino acids 82 to 101 (20 residues), see Phobius details amino acids 107 to 129 (23 residues), see Phobius details amino acids 146 to 159 (14 residues), see Phobius details amino acids 163 to 191 (29 residues), see Phobius details amino acids 245 to 266 (22 residues), see Phobius details amino acids 277 to 295 (19 residues), see Phobius details amino acids 307 to 328 (22 residues), see Phobius details amino acids 335 to 353 (19 residues), see Phobius details amino acids 365 to 387 (23 residues), see Phobius details amino acids 393 to 412 (20 residues), see Phobius details PF07690: MFS_1" amino acids 19 to 379 (361 residues), 97.4 bits, see alignment E=8.2e-32 amino acids 248 to 415 (168 residues), 51.3 bits, see alignment E=8.6e-18 PF12832: MFS_1_like" amino acids 30 to 398 (369 residues), 32 bits, see alignment E=7.1e-12

Best Hits

KEGG orthology group: K03291, MFS transporter, SET family, sugar efflux transporter (inferred from 100% identity to bpy:Bphyt_5278)

Predicted SEED Role

"Sugar efflux transporter B"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TDC6 at UniProt or InterPro

Protein Sequence (444 amino acids)

>BPHYT_RS26230 MFS transporter (Burkholderia phytofirmans PsJN)
MLKTSRFFDLLRIPGFKPLAAATLMLGVAMSFTAPYLSLFGVERAGMTPFRLGVFMTLIA
ASGVLASTFAGRWSDASGRHRPLLLAALIAAALGYLCLCVVRDYRLLLVVGIVFIGAGGS
AISMVFSFSRAALPVADPAERVFASATLRTILSAAWVFGPSVGALVLAASSFYGLFLFAA
ASFGACATIVWRMREPQGHLGDHTVEDTASEPSASITVPPLTTPGEEAHENLPGVASAND
IGRAVAALTLLGLAANATMIVLPLYIVHGLNGTHLDVSIMLGLGALMEIPMMLALGAKSS
ALHKPNWLAACAAVHAVYFVGMSLAGSVHVLIPMQMLNAFVVAVTSCLGMTYVQDLMPHA
PGRATALFFNAARVGSILSGVLSGLLVQAFSYRGTFLFCGLLALCALVLFAVPGDRYPLM
WKAVKRFARSQYGKLQARQRERQR