Protein Info for BPHYT_RS26200 in Burkholderia phytofirmans PsJN

Annotation: acetate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00016: acetate kinase
  • amino acids 9 to 361 (353 residues), 306.5 bits, E=1.2e-95
• PF00871: Acetate_kinase
  • amino acids 12 to 357 (346 residues), 311.5 bits, E=3.6e-97

Best Hits

Swiss-Prot: 38% identical to ACKA_PORGI: Acetate kinase (ackA) from Porphyromonas gingivalis (strain ATCC BAA-308 / W83)

KEGG orthology group: K00925, acetate kinase [EC: 2.7.2.1] (inferred from 100% identity to bpy:Bphyt_5272)

Predicted SEED Role

"Acetate kinase (EC 2.7.2.1)" in subsystem Ethanolamine utilization or Fermentations: Lactate or Fermentations: Mixed acid or Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate or Threonine anaerobic catabolism gene cluster (EC 2.7.2.1)

MetaCyc Pathways

• Bifidobacterium shunt (14/15 steps found)
• superpathway of L-threonine metabolism (16/18 steps found)
• mixed acid fermentation (13/16 steps found)
• ethanolamine utilization (5/5 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (15/19 steps found)
• superpathway of N-acetylneuraminate degradation (17/22 steps found)
• acetyl-CoA fermentation to butanoate (6/7 steps found)
• pyruvate fermentation to acetate II (3/3 steps found)
• superpathway of acetate utilization and formation (3/3 steps found)
• L-threonine degradation I (5/6 steps found)
• acetate and ATP formation from acetyl-CoA I (2/2 steps found)
• acetylene degradation (anaerobic) (4/5 steps found)
• pyruvate fermentation to acetate and (S)-lactate I (3/4 steps found)
• pyruvate fermentation to acetate I (2/3 steps found)
• pyruvate fermentation to acetate IV (2/3 steps found)
• pyruvate fermentation to acetate VII (2/3 steps found)
• glycine degradation (reductive Stickland reaction) (1/2 steps found)
• superpathway of L-alanine fermentation (Stickland reaction) (6/9 steps found)
• (S)-propane-1,2-diol degradation (3/5 steps found)
• pyruvate fermentation to acetate and lactate II (2/4 steps found)
• purine nucleobases degradation II (anaerobic) (16/24 steps found)
• superpathway of Clostridium acetobutylicum acidogenic fermentation (5/9 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (5/9 steps found)
• lactate fermentation to acetate, CO₂ and hydrogen (Desulfovibrionales) (4/8 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (10/17 steps found)
• methanogenesis from acetate (2/6 steps found)
• reductive glycine pathway of autotrophic CO₂ fixation (4/9 steps found)
• gallate degradation III (anaerobic) (5/11 steps found)
• L-lysine fermentation to acetate and butanoate (3/10 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (5/13 steps found)
• purine nucleobases degradation I (anaerobic) (6/15 steps found)
• superpathway of methanogenesis (3/21 steps found)
• superpathway of L-lysine degradation (11/43 steps found)

KEGG Metabolic Maps

• Propanoate metabolism
• Pyruvate metabolism
• Taurine and hypotaurine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.2.1

Sequence Analysis Tools

See B2TDC0 at UniProt or InterPro

Protein Sequence (386 amino acids)

>BPHYT_RS26200 acetate kinase (Burkholderia phytofirmans PsJN)
MHTENSADDQTILVLNSGSSSLKFGLFRRAGNDESLLLEGSAEGIGRDDGSLRIKAPDGR
VLVQQERVLESQIDALQKLAQVLKEQHHARPAAVGHRVVHGGPRLRTHQRITADVRRQLH
EAVHFAPLHIPPALALIDEAEKIFDDAPHFACFDTAFHATLPLRAAHLALPRRYAEAGVM
RYGFHGLSYESLVTRLGADLPARAVFAHLGNGSSVCALRDGRSIDTSMGLTPTGGVPMGT
RSGDLDPGVLLYLMRVEKLDAGALETLLNRQSGLAGYADGESDMQALEKRAAAGDTNASL
ALDAFATAVRKTIGGYAALLGGIDLLVFTGGIGEHSQEIRKRVCDGLAFMGLTQSDPAGK
VRAIHTEEEKQIARHCRTLLQQATQA