Protein Info for BPHYT_RS26155 in Burkholderia phytofirmans PsJN

Annotation: carboxylesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF12146: Hydrolase_4
  • amino acids 8 to 239 (232 residues), 48.6 bits, E=1e-16
• PF00561: Abhydrolase_1
  • amino acids 9 to 138 (130 residues), 26 bits, E=1e-09
• PF12697: Abhydrolase_6
  • amino acids 10 to 245 (236 residues), 50.1 bits, E=8.6e-17

Best Hits

KEGG orthology group: K03928, carboxylesterase [EC: 3.1.1.1] (inferred from 100% identity to bpy:Bphyt_5263)

Predicted SEED Role

"alpha/beta hydrolase fold"

MetaCyc Pathways

• methylsalicylate degradation (2/2 steps found)
• aspartame degradation (1/2 steps found)
• methyl indole-3-acetate interconversion (1/2 steps found)
• superpathway of methylsalicylate metabolism (1/5 steps found)
• retinol biosynthesis (2/7 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis II
• Drug metabolism - other enzymes

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.1

Use Curated BLAST to search for 3.1.1.1

Sequence Analysis Tools

See B2TDB1 at UniProt or InterPro

Protein Sequence (289 amino acids)

>BPHYT_RS26155 carboxylesterase (Burkholderia phytofirmans PsJN)
MFFPGDDHAVLMLHGLSSSPLELRFLARFLNAEGFTTCAPLLPGYSAGSDEAAMETWIEA
AVREYDALAARFTRVSICGLSIGAALALALAQRRPQAQSLVLLSLTLSYDGWAMPWYRFL
LDWAYYTPLRKRWRYREAAPFGLRNEALRAKIARAMQRSDFSEVGPSTISLPALHEASRL
ASNVRALVRDIKTDCLIVHAIDDETSSPRNARFVAGHIGAAFLRTIWLDDSYHMITSDNE
REIVARETALFLRESEAAHSGDEGGKQPVVSKALARRLRQLAALGKERA