Protein Info for BPHYT_RS26130 in Burkholderia phytofirmans PsJN

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 transmembrane" amino acids 26 to 50 (25 residues), see Phobius details amino acids 92 to 112 (21 residues), see Phobius details amino acids 123 to 144 (22 residues), see Phobius details amino acids 171 to 194 (24 residues), see Phobius details amino acids 230 to 252 (23 residues), see Phobius details amino acids 273 to 295 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 102 to 290 (189 residues), 44.5 bits, see alignment E=7.5e-16

Best Hits

KEGG orthology group: K02054, putative spermidine/putrescine transport system permease protein (inferred from 100% identity to bpy:Bphyt_5258)

Predicted SEED Role

"ABC transporter permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TDA6 at UniProt or InterPro

Protein Sequence (304 amino acids)

>BPHYT_RS26130 ABC transporter permease (Burkholderia phytofirmans PsJN)
MATIELPSHAQDEPVKHRRAPAWLQATPLSLTFLLFFIVPLVITLIVSFWDFNEYQIIPA
FTLKNYAAIFNGCSSLTDVCVTFKTYWSTLKFCAIVWAVTLLLGFSIAYFLAFHVRTTSM
QTVLFLVCTIPFWTSNVIRMISWMPLLGRNGLVNQALLGAHLIDQPLEWLLYSNFSVVLA
FVHLYTFFMIVPIFNAMMRIDRSLLEAARDAGASGWQVVRDVVLPLSKTGIVIGSIFVIT
IVMGDFLTVGVMGGQQIASVGKIIQVQTGYLQFPAAAANAIMLLAVVLMIVWGLTRVVDI
RKEL