Protein Info for BPHYT_RS26085 in Burkholderia phytofirmans PsJN

Annotation: ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF02608: Bmp" amino acids 32 to 286 (255 residues), 134.8 bits, see alignment E=1.7e-43

Best Hits

KEGG orthology group: K07335, basic membrane protein A and related proteins (inferred from 100% identity to bpy:Bphyt_5249)

Predicted SEED Role

"Nucleoside ABC transporter, periplasmic nucleoside-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TD97 at UniProt or InterPro

Protein Sequence (325 amino acids)

>BPHYT_RS26085 ABC transporter substrate-binding protein (Burkholderia phytofirmans PsJN)
MSIATLKTLATCVVALAASTSAIHAVAADPLRVGVLIPGSKSDKGWMESGYDGLVAAQKE
LGPKLKTQMIENINYADMEQALTNLASKNQLVIGVGGQTQASVLKIAKRFPNVKFAIVGG
NKGQDMPPNVAGYDVKQAEIAYVAGAAAAMLSKNGAVSYVGGMEIPSIVNAGKEFGNGAR
SINPKIKYFESYTGDFDNVSKAKEATLAAISQGADVHYHILNLGLRGMEQAASEKHTHVI
GSYTDRCGTDPLYIAYSITGVGYQVQYAIDQMAAGTWQPGYKAFGLAMGPKASGMVVCSP
TPQMSTKIKQIEQDIESGKIKVSEG