Protein Info for BPHYT_RS26050 in Burkholderia phytofirmans PsJN

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 371 signal peptide" amino acids 1 to 40 (40 residues), see Phobius details transmembrane" amino acids 58 to 80 (23 residues), see Phobius details amino acids 84 to 108 (25 residues), see Phobius details amino acids 114 to 137 (24 residues), see Phobius details amino acids 148 to 166 (19 residues), see Phobius details amino acids 198 to 216 (19 residues), see Phobius details amino acids 237 to 260 (24 residues), see Phobius details amino acids 271 to 289 (19 residues), see Phobius details amino acids 296 to 315 (20 residues), see Phobius details amino acids 327 to 345 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 63 to 334 (272 residues), 98.8 bits, see alignment E=1.6e-32

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to bpy:Bphyt_5242)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TD90 at UniProt or InterPro

Protein Sequence (371 amino acids)

>BPHYT_RS26050 ABC transporter permease (Burkholderia phytofirmans PsJN)
MRPNASAARVMLSFLPALPTVLAVLGTLLLFSLFLLAQGQPAPDAIALIFQGAFGSSFAW
QSTLLRAAPLMLTALCVALPAQVGLIVIGGEGALALGGMCAAIVPQMLPHNTPWLIATPL
MALAGMLAGGVWIGAVGALRQWRGVNETISSLLMSYIAIAVFKHLVEGPLRDPASLNKPS
TLPVPDAMMIGSIPGLDTHWGLFWGVVACIAAWVFVKFSTKGFAMRVVGGSNRAARLVGL
PVNMLALTACVLGGAAAGLGGMFEVAAVQGSANASLLAGYGYAGILVAFAARQNPLAIIA
CALMIGGIEASGSLLQRRLDLPDATTLVLQGLLFANLLAWEALGGRIAAWRVKLQAIAQT
DLPVQLERTHA