Protein Info for BPHYT_RS26010 in Burkholderia phytofirmans PsJN

Annotation: ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details PF13379: NMT1_2" amino acids 35 to 262 (228 residues), 36.5 bits, see alignment E=4.9e-13 PF09084: NMT1" amino acids 46 to 197 (152 residues), 54.1 bits, see alignment E=2.1e-18

Best Hits

KEGG orthology group: K02051, sulfonate/nitrate/taurine transport system substrate-binding protein (inferred from 100% identity to bpy:Bphyt_5234)

Predicted SEED Role

"Urea carboxylase-related ABC transporter, periplasmic substrate-binding protein" in subsystem Urea decomposition

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TD82 at UniProt or InterPro

Protein Sequence (336 amino acids)

>BPHYT_RS26010 ABC transporter substrate-binding protein (Burkholderia phytofirmans PsJN)
MASALRTRGALAVAAAALAIGLAAGPAASPAQAAAAPLAIGYSDWPGFVAFQIAIEKGWF
KEAGVDVNFQWFDYSASLDAFSAGKLDAVGATNGDALVTGASGAKNVMILLTDYSSGNDM
IVAKPPVRTVEGLKGKKVGVEMGLVDHLLLDTALEKHALKESDLTLVNAKTNELPQVLAS
SGDVAAVGAWQPNAGEALKRVPGSRPIFTSADAPGLIYDAITVNPVSLQSRKADWAKVIK
VWYRCVAYINDPKTQPDAVKIMSARVGLTPAQYLPLLKGTHLLDAAAAKKAFTKGDGLDS
VYGSSVNADKFNVRNAVYKQSQNVSAYIDPTLATAQ