Protein Info for BPHYT_RS25995 in Burkholderia phytofirmans PsJN

Annotation: 2OG-Fe(II) oxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 PF14226: DIOX_N" amino acids 11 to 135 (125 residues), 106.5 bits, see alignment E=1.4e-34 PF03171: 2OG-FeII_Oxy" amino acids 180 to 274 (95 residues), 81.2 bits, see alignment E=6e-27

Best Hits

Swiss-Prot: 34% identical to HXNY_EMENI: 2-oxoglutarate-Fe(II) type oxidoreductase hxnY (hxnY) from Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)

KEGG orthology group: K06892, (no description) (inferred from 100% identity to bpy:Bphyt_5231)

Predicted SEED Role

"2-Oxobutyrate oxidase, putative" in subsystem Methionine Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TD79 at UniProt or InterPro

Protein Sequence (351 amino acids)

>BPHYT_RS25995 2OG-Fe(II) oxygenase (Burkholderia phytofirmans PsJN)
MNPTHTSFQQLPVVDVSGLFSDDDAQRLATARELDRAAREAGFFYVTGHQVSRAQQSALI
EQAKRFFAAEHEWKMRYYIGKSTAHRGYVPEGEEVFAGGKRDRKEAFDTGRELPADDPDV
RAGTPMLGPNSWPEQAGFREAVGGYYKAAFELGRALFRGFSLALGLPEQHFDQYLRKPPS
QLRLIHYPLDPSAEDRPGIGAHTDYECFTILLPTAPGLEVMNGEGEWIDAPPVENAFVVN
IGDMLEVWTGGTYVATSHRVRKVREERYSFPLFFACDYHTVVAPLPQFATPEAVAKYPPV
SAGDHLFAQTAQSFTYLKERLQRGELLLPDGSKALASFGQQARYASAEMDT