Protein Info for BPHYT_RS25935 in Burkholderia phytofirmans PsJN

Annotation: type III secretion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 637 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 381 to 403 (23 residues), see Phobius details PF03958: Secretin_N" amino acids 198 to 333 (136 residues), 43.6 bits, see alignment E=2.9e-15 TIGR02516: type III secretion outer membrane pore, YscC/HrcC family" amino acids 294 to 565 (272 residues), 246 bits, see alignment E=3e-77 PF00263: Secretin" amino acids 407 to 565 (159 residues), 120.7 bits, see alignment E=5.2e-39

Best Hits

KEGG orthology group: K03219, type III secretion protein SctC (inferred from 100% identity to bpy:Bphyt_5220)

Predicted SEED Role

"Type II secretory pathway, component PulD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TD05 at UniProt or InterPro

Protein Sequence (637 amino acids)

>BPHYT_RS25935 type III secretion protein (Burkholderia phytofirmans PsJN)
MFLTRRVISAKGEGRYARRYPAVIGIRSAFAVGIILYASMGSTAEPVWGTQALHYFARNT
PLPDVLKAVVSAAGLQVEIARGVKGPVNGAFDDPPSRVFAKLVEAYGLAWYFDGNVIHVS
PASDIRSRTIPFAPMTREEVAGLLSSLGLADSRLPVRYSDTTAVVSGPSGFVDAVSSAVA
EAQRQTTITPSVDETVIRVFPLQYAQAQDITYTSGNQRQVVPGVASLLRKLMADVPVSVP
DRENATRSRNQARAERGGPPPLPSLRGLGLAGLQQEPELDPLLPVAEVMRPAAAPIQRNI
VADARTNSVVIYDVPSMMPSYARTIAMLDKQQDLVEITAVVIDITSDAASDLGIHWGGAT
RGGAGGYAVMNSSPTVLASSLIPALAGLNLATMIGSSANYLFAKIHLLEQSGKARILSRP
QVLTLNNSEAILSSRNSLYVRVAGNQDVDLYNVDTGLTLKVTPTVESGSDSARNILLSVQ
IDDGAFDSSLSVDGIPKVNNHSIVTQAVVADGESLLLGGYEYERSQTASSQVHVLGHLPY
VGALFRDTQTQVERLERLILITPRVKPMVKLVTEPDGANGVSTSSLEHPAPSFPSSAGIA
RAAVRQRPEDMSVWNGVTPPLPPGLPPGPSAPTGQIR