Protein Info for BPHYT_RS25895 in Burkholderia phytofirmans PsJN

Annotation: type III secretion system protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 transmembrane" amino acids 7 to 33 (27 residues), see Phobius details amino acids 50 to 70 (21 residues), see Phobius details amino acids 157 to 181 (25 residues), see Phobius details amino acids 193 to 214 (22 residues), see Phobius details PF00813: FliP" amino acids 15 to 209 (195 residues), 192.3 bits, see alignment E=4.4e-61

Best Hits

KEGG orthology group: K03226, type III secretion protein SctR (inferred from 100% identity to bpy:Bphyt_5212)

Predicted SEED Role

"Type III secretion inner membrane protein (YscR,SpaR,HrcR,EscR,homologous to flagellar export components)" in subsystem Type III secretion systems, extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TCZ7 at UniProt or InterPro

Protein Sequence (215 amino acids)

>BPHYT_RS25895 type III secretion system protein (Burkholderia phytofirmans PsJN)
MKDQVVNFQIIVFFFVLGLLPLIVTMTTSFTKFSIVLTLLRSAVGVQQAPGNMAISALAL
AATLVVMAPTMEKIGGDLSLGERVERGQFPDVTEVYQAVRGPLGEFMMEHSRPSERAFLV
TAAKRIDPARDAQETDFSLLIPAFMISEISSGFEAGFLLYMAFLIIDLVIANVLTAMGMV
MLSPTTVSTPLKLFVLVSVSGISKLMHGLIVSYAK