Protein Info for BPHYT_RS25885 in Burkholderia phytofirmans PsJN

Annotation: type III secretion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 35 to 53 (19 residues), see Phobius details amino acids 66 to 89 (24 residues), see Phobius details amino acids 116 to 138 (23 residues), see Phobius details amino acids 176 to 197 (22 residues), see Phobius details amino acids 209 to 227 (19 residues), see Phobius details PF01311: Bac_export_1" amino acids 10 to 228 (219 residues), 139.3 bits, see alignment E=7.8e-45

Best Hits

KEGG orthology group: K03228, type III secretion protein SctT (inferred from 100% identity to bpy:Bphyt_5210)

Predicted SEED Role

"Flagellar biosynthesis protein FliR" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TCZ5 at UniProt or InterPro

Protein Sequence (230 amino acids)

>BPHYT_RS25885 type III secretion protein (Burkholderia phytofirmans PsJN)
MTDYIGYVEGFAFCTIRPVVALSLVPFGGSESLGVTLRLPLMLMFATLPQQIGWPADPIV
AASVEVLVGLLLGLLLSVAFHAAGAAGALIDQQGGYSIGSSYDPNFRDESALFERLFIWL
ATLTFFTGKGLQAVYGFFADAWVLWPPGAPRPDHMRVMRELAEQRLPLSMVEGARIAMPL
IGMMLLVDISMGLMSRYAKRLNPFTTARTVKAIVLSLVIVACVPVLIERL