Protein Info for BPHYT_RS25875 in Burkholderia phytofirmans PsJN

Annotation: type III secretion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 691 transmembrane" amino acids 20 to 37 (18 residues), see Phobius details amino acids 43 to 65 (23 residues), see Phobius details amino acids 77 to 100 (24 residues), see Phobius details amino acids 112 to 136 (25 residues), see Phobius details amino acids 204 to 225 (22 residues), see Phobius details amino acids 245 to 264 (20 residues), see Phobius details amino acids 285 to 305 (21 residues), see Phobius details amino acids 309 to 328 (20 residues), see Phobius details PF00771: FHIPEP" amino acids 31 to 676 (646 residues), 616.2 bits, see alignment E=3.9e-189

Best Hits

KEGG orthology group: K03230, type III secretion protein SctV (inferred from 100% identity to bpy:Bphyt_5208)

Predicted SEED Role

"Flagellar biosynthesis protein FlhA" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TCZ3 at UniProt or InterPro

Protein Sequence (691 amino acids)

>BPHYT_RS25875 type III secretion protein (Burkholderia phytofirmans PsJN)
MMKNMKLGNIDLPGLIARHADLAVGAGMLSVLVLLILPVPSFVLDLFICVSFTASFVMLA
ATIYAAKPVELSSFPSLLLVTTLLRLALAIASTKMILLYAHAGQIIGAFGEIVVGGNVAV
GMVVFIVLSAIQFIVVAKGADRVAEVSARFTLDGIPGRQMSIDADLRGGLIGASEAGRLR
GELERETYFYGSLDGAMKFVKGDAIAGLVVALVNIAGGLAVGIAQRGMSLAEALHTYTIL
TVGDGLVSQIPSLIVSISAGLLVTRVSSGGVGGNLGGDIFKQLSAHPPAMVMAGTACLAL
ACIPGFPHIQFVLAAVVLIGLAVALMRQRAAADRAARPKMPAMTRDGGNYVQRILDDVEL
GTSSPLRVRLGSAACNALNAAELNDQLAQLRRDLIVRLGVPFPGLVLLRDPRLDVDRYIV
DIDDVPFSGGTLLAGHVLVSGDTERVTMEGPPGYHPRAEKSVWVRADSAAGIDDTQLMKS
SANGLLCDHLMDVCEKCAPSFVGTQETRFLLNLVGAEFRELVTVAQKVVTTAQIAAVLRS
LLEQRVSIRNMRAILEAIVQVPDSERSHDRMVRDARIALAPQLVRSYADLSSWEVHAAVL
EPSWEAELEAQIDLGPDGEPRCVLDADRLESLQRGFAARNDVVRLVVTTAVLRPHLERVL
RTLGMRTDVLAMEEIPLDEYRVRVIATLAPA