Protein Info for BPHYT_RS25805 in Burkholderia phytofirmans PsJN

Updated annotation (from data): deoxyribose kinase (EC 2.7.1.15)
Rationale: Specifically important in carbon source 2-Deoxy-D-Ribose
Original annotation: ribokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 PF00294: PfkB" amino acids 12 to 304 (293 residues), 202.4 bits, see alignment E=1.1e-63 TIGR02152: ribokinase" amino acids 13 to 310 (298 residues), 301 bits, see alignment E=4.9e-94 PF08543: Phos_pyr_kin" amino acids 179 to 283 (105 residues), 37.8 bits, see alignment E=1.4e-13

Best Hits

Swiss-Prot: 42% identical to RBSK_HAEIN: Ribokinase (rbsK) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K00852, ribokinase [EC: 2.7.1.15] (inferred from 100% identity to bpy:Bphyt_5194)

MetaCyc: 39% identical to ribokinase (Escherichia coli K-12 substr. MG1655)
Ribokinase. [EC: 2.7.1.15]

Predicted SEED Role

"Ribokinase (EC 2.7.1.15)" in subsystem D-ribose utilization or Deoxyribose and Deoxynucleoside Catabolism (EC 2.7.1.15)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.15

Use Curated BLAST to search for 2.7.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TCX9 at UniProt or InterPro

Protein Sequence (328 amino acids)

>BPHYT_RS25805 deoxyribose kinase (EC 2.7.1.15) (Burkholderia phytofirmans PsJN)
MNTPAQLNGKGRVVILGIYVTDLTFRAGRMPQIGETIAGTAFAMGPGGKGSNQAVAAARV
GADVVFCTRIGNDAFGSIARATWAAEGITARASVIDGVSTGAAHIFVDDNTGMNAIIVAS
GAAGTMEAADVDAIEADIAAARVFVTQLEQPLAAARRGLEVARKHGVITVFNPAPAMPLD
DAIFPLCDYITPNETEATALTGVPIANADDARRAADVLLAKGVGTAIITLGEGGALLHSA
NQSLLVPAYHCGRVVETAGAGDGFTGGFAAALARGDDAITALRFGCALAGISVTRPGTAP
SMPTLDEVNQVLNQPSQPNQAAGVSQPS