Protein Info for BPHYT_RS25800 in Burkholderia phytofirmans PsJN

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 transmembrane" amino acids 16 to 34 (19 residues), see Phobius details amino acids 54 to 72 (19 residues), see Phobius details amino acids 77 to 95 (19 residues), see Phobius details amino acids 102 to 125 (24 residues), see Phobius details amino acids 134 to 154 (21 residues), see Phobius details amino acids 174 to 195 (22 residues), see Phobius details amino acids 225 to 244 (20 residues), see Phobius details amino acids 256 to 273 (18 residues), see Phobius details amino acids 280 to 299 (20 residues), see Phobius details amino acids 305 to 323 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 53 to 317 (265 residues), 104.3 bits, see alignment E=3.3e-34

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to bpy:Bphyt_5193)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TCX8 at UniProt or InterPro

Protein Sequence (352 amino acids)

>BPHYT_RS25800 sugar ABC transporter permease (Burkholderia phytofirmans PsJN)
MKSAFTAGKLFGDRQLNFLLIVNVLVVLVATWLSRGQFVDIDNLQSMGGQLPELGLLALG
IMLSMVSGNGGIDLSGVGLANLSGMVAALIVPRFVNGDDSPALYTSLFCVIVVTMGLLGG
LLNGVVIARLRLTPILCTLGTQLLFTGFAVVLSNGASVHVDYVDPLSNIGNGTVFQVPIA
FCIFIAAVIVLGWLLKRSPFGLRLYLMGTNPKAAFYAGIPRARMLITTYAMCGVLASLAG
LISVTHTSSAKWDYGNSYLLIAILIAVMGGVNPAGGHGRIICVFFAATVLQFLSSLFNLM
GVSQFFGDCAWGFLLLLSLAFAGGERVRAIFGFGGGAGASNAASPASSTPKS