Protein Info for BPHYT_RS25660 in Burkholderia phytofirmans PsJN

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 transmembrane" amino acids 30 to 48 (19 residues), see Phobius details amino acids 65 to 84 (20 residues), see Phobius details amino acids 96 to 115 (20 residues), see Phobius details amino acids 121 to 142 (22 residues), see Phobius details amino acids 154 to 177 (24 residues), see Phobius details amino acids 189 to 211 (23 residues), see Phobius details amino acids 254 to 275 (22 residues), see Phobius details amino acids 287 to 308 (22 residues), see Phobius details amino acids 320 to 340 (21 residues), see Phobius details amino acids 346 to 366 (21 residues), see Phobius details amino acids 375 to 398 (24 residues), see Phobius details amino acids 410 to 429 (20 residues), see Phobius details PF07690: MFS_1" amino acids 34 to 396 (363 residues), 149.7 bits, see alignment E=5.4e-48

Best Hits

Swiss-Prot: 49% identical to NICT_PSEPK: Putative metabolite transport protein NicT (nicT) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_5164)

Predicted SEED Role

"Major facilitator family transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TCV0 at UniProt or InterPro

Protein Sequence (452 amino acids)

>BPHYT_RS25660 MFS transporter (Burkholderia phytofirmans PsJN)
MSVPSFGPEPCLASADPHNALLYAKLTRRIVPFLFFAFVVAYIDRVNVSFAKLQMLSDLS
LSETVYGAGAGIFFVGYFFFEVPSNLILNRVGARRWIARIMVTWALVSGLTMFVNGPTSF
YVMRFLLGVAEAGFFPGILLYLSNWFPSTRRSQIIALFMTAIPVSGAIGGPLSGWLMAHF
AGTYGLAGWRWLFLVEGIGSLAVGIAAFFVLHDRIDNVRWLNADEKSRLAADLARDAITR
TETSARGAFASKRVWLLGLLYFCIAMGNYGLAFWVPTIIKASGVASLANIGWLSAVPSLI
SVVAMVLIARHADRHDERRVHVAVCCAIGALGLLASVLFASNVAVSIAALVVAAIGINSI
APVFWGIPTALLGGAGAAAGIAVINCTGNLAGFVSPFIVGRLSDLSGGKLLPGMLAIAVA
LLIGAAIVLRMPLKRVCAASASAPNSSIPQRT