Protein Info for BPHYT_RS25640 in Burkholderia phytofirmans PsJN

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 transmembrane" amino acids 24 to 46 (23 residues), see Phobius details amino acids 56 to 75 (20 residues), see Phobius details amino acids 96 to 114 (19 residues), see Phobius details amino acids 120 to 140 (21 residues), see Phobius details amino acids 160 to 183 (24 residues), see Phobius details amino acids 195 to 214 (20 residues), see Phobius details amino acids 247 to 268 (22 residues), see Phobius details amino acids 284 to 302 (19 residues), see Phobius details amino acids 313 to 333 (21 residues), see Phobius details amino acids 339 to 362 (24 residues), see Phobius details amino acids 374 to 397 (24 residues), see Phobius details amino acids 403 to 424 (22 residues), see Phobius details PF00083: Sugar_tr" amino acids 25 to 230 (206 residues), 73.6 bits, see alignment E=2.3e-24 PF07690: MFS_1" amino acids 44 to 334 (291 residues), 101.4 bits, see alignment E=7.9e-33 amino acids 263 to 420 (158 residues), 45.9 bits, see alignment E=5.8e-16 PF13347: MFS_2" amino acids 164 to 365 (202 residues), 27.7 bits, see alignment E=1.5e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_5160)

Predicted SEED Role

"L-Proline/Glycine betaine transporter ProP" in subsystem Proline, 4-hydroxyproline uptake and utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TCU6 at UniProt or InterPro

Protein Sequence (444 amino acids)

>BPHYT_RS25640 MFS transporter (Burkholderia phytofirmans PsJN)
MQNLEAVNVRSASFNRLTAGQWRLIILASLGGALEFYDFVVYGVFAQFIGRAFFSMLDPM
MALLLSFAVFAIGYLSRPVGGAVLSWFGDRFGRRRVFIVSVIIVSLSTIGMGLVPTYASW
GIAATFTMILLRLVQGFCLGGELPGSITYVVETVPRRAGFVCGIVFFCVNSGVLLAAAVN
LGVHAVLTPDDVAAYGWRFAFIFGGVIGLLGFWLRRKLEETPEFAHMKQFASKHPFAELL
REHWRPVVLGILTTCATAGYNGLLFAHMPAYLDKVLHYDPHQVALGQNVALATASIGILI
VGRIGDSMPRRHLMRAGALLLIILTMPFYHAAVSHQMDLIVLMLLGGLGAALINGTFACI
IADMFPTRVRFSGVALAFNLSFTLFSGTAPLIGTWLISRTGDLAAPGYFMVACALLTFVA
TFGLKALSGKIAAPDAPATAMNSR