Protein Info for BPHYT_RS25590 in Burkholderia phytofirmans PsJN

Annotation: FAD-dependent pyridine nucleotide-disulfide oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 696 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 68 to 90 (23 residues), see Phobius details amino acids 106 to 125 (20 residues), see Phobius details amino acids 157 to 176 (20 residues), see Phobius details amino acids 188 to 210 (23 residues), see Phobius details amino acids 213 to 232 (20 residues), see Phobius details amino acids 238 to 261 (24 residues), see Phobius details amino acids 281 to 298 (18 residues), see Phobius details amino acids 320 to 335 (16 residues), see Phobius details amino acids 648 to 675 (28 residues), see Phobius details PF00070: Pyr_redox" amino acids 281 to 315 (35 residues), 24.2 bits, see alignment (E = 5.9e-09) amino acids 434 to 517 (84 residues), 30.1 bits, see alignment E=8.4e-11 PF07992: Pyr_redox_2" amino acids 281 to 597 (317 residues), 163.6 bits, see alignment E=1.1e-51 PF13450: NAD_binding_8" amino acids 284 to 313 (30 residues), 26.3 bits, see alignment (E = 1.1e-09)

Best Hits

KEGG orthology group: K03885, NADH dehydrogenase [EC: 1.6.99.3] (inferred from 100% identity to bpy:Bphyt_5149)

Predicted SEED Role

"NADH dehydrogenase (EC 1.6.99.3)" in subsystem Carboxysome or Respiratory dehydrogenases 1 (EC 1.6.99.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.99.3

Use Curated BLAST to search for 1.6.99.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TCT6 at UniProt or InterPro

Protein Sequence (696 amino acids)

>BPHYT_RS25590 FAD-dependent pyridine nucleotide-disulfide oxidoreductase (Burkholderia phytofirmans PsJN)
MLRKTLKRACGFGLALRVLCMPWVLLFARIWFGQVVFVHQIMTMAEGPNDGLFSGGLHVP
SGLDAALHSVVPLLLTMGLLARPVALVLLIETIADSHGALAVGAQGAKLALLSWLIVSGA
GAMSLDNLLGRGVSWIPFRPIRLTRGLYVWFERYLGPLLQFVIRAGLATSLVNFVLPTGS
LLQKSMLGAAATSPVHPAWCAAALALALTLGCATRFAALVIAVMVPVAGIAMSTDDRLAV
LLLLLVLVVAGGGAFSVDWLLDRWTGTKSQEDDSDPEDLPHVVVVGGGFGGVAAAQGLRN
ARCRVTLIDQRNHHLFQPLLYQVATAALSPAEIATPIRSLFRRQRNVQVMLGQVTGVDAV
AREVHVGTLAVKFDYLVLATGARHSYFGKDSWAPFAPGLKSIEDATDVRSRLLRAFEEAE
SAASETERAAWLTFVIVGGGPTGIELAGAIAELARHGMAEEYRKIDPARARVILLQSGPR
ILPTFAATLSGAAERSLQALGVEVRLDTRVLGVDSEGVDIGGQRIAARTVLWAAGVAASP
AAQWLNRTADPSGRLAVGADLSVPDLQRIYAIGDTASCLGWRGAVVPGLAPAAKQQGLYV
AGVIAASLSGRRPPPPFRYRHFGSLATIGRQAAVAEIGKLRVWGEPAWWFWGAIHIAFLV
GGRNRAIVVLDWLWAYLTYRRSTRLITGDTRDKMMD