Protein Info for BPHYT_RS25450 in Burkholderia phytofirmans PsJN

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 transmembrane" amino acids 20 to 48 (29 residues), see Phobius details amino acids 60 to 83 (24 residues), see Phobius details amino acids 95 to 114 (20 residues), see Phobius details amino acids 119 to 139 (21 residues), see Phobius details amino acids 159 to 182 (24 residues), see Phobius details amino acids 194 to 213 (20 residues), see Phobius details amino acids 244 to 265 (22 residues), see Phobius details amino acids 278 to 297 (20 residues), see Phobius details amino acids 309 to 328 (20 residues), see Phobius details amino acids 334 to 357 (24 residues), see Phobius details amino acids 374 to 396 (23 residues), see Phobius details amino acids 402 to 421 (20 residues), see Phobius details PF00083: Sugar_tr" amino acids 25 to 213 (189 residues), 67.9 bits, see alignment E=8.6e-23 amino acids 227 to 419 (193 residues), 38.3 bits, see alignment E=8e-14 PF07690: MFS_1" amino acids 29 to 293 (265 residues), 66.9 bits, see alignment E=1.6e-22 amino acids 292 to 419 (128 residues), 37.2 bits, see alignment E=1.8e-13

Best Hits

KEGG orthology group: K03762, MFS transporter, MHS family, proline/betaine transporter (inferred from 100% identity to bpy:Bphyt_5120)

Predicted SEED Role

"Citrate-proton symporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TCQ7 at UniProt or InterPro

Protein Sequence (429 amino acids)

>BPHYT_RS25450 membrane protein (Burkholderia phytofirmans PsJN)
MHTAATVTDTVSIETRRSSFYWIIMAASIGNALEWFDILIYGFFATIIAKTFFPASNSTV
SLLITLGTFGISYLVRPVGALVLGSYADRRGRKASMMVSIVMMMLGTAVIALMPGYATIG
VAAPIAVVCARMIQGFSAGGEFGSTTAFMVEQAPERKGFIASFQFASQGLSYLLAAGFGV
LLTNTLDTAALESWGWRLPFFFGILIGPVGLYLRKHVHEGQIFQEAKSGEHPVSTVFARQ
KGRMLLAIGTLVLSTGTSYVILYIPTYAVRQLHLPESFGFMATMLTGAILTFVTPFVGHL
SDRVGRVRMMAWAGIVFTLTIYPVFKVIGEHAGLGALMAMMAWVGLLKAVYFGALPALMA
ETFPVETRATGMAISYNIGVTIFGGFAPLIVASLIQATGSKLAPAFYLMLLGVISLVALW
RCRTTLNLR