Protein Info for BPHYT_RS25380 in Burkholderia phytofirmans PsJN

Annotation: acyl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 PF02771: Acyl-CoA_dh_N" amino acids 10 to 121 (112 residues), 41.6 bits, see alignment E=2.2e-14 PF02770: Acyl-CoA_dh_M" amino acids 125 to 219 (95 residues), 75.4 bits, see alignment E=4.8e-25 PF00441: Acyl-CoA_dh_1" amino acids 231 to 396 (166 residues), 69.4 bits, see alignment E=5.9e-23

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_5104)

MetaCyc: 46% identical to pimeloyl-CoA dehydrogenase large subunit (Rhodopseudomonas palustris)
Pimeloyl-CoA dehydrogenase. [EC: 1.3.1.62]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.1.62

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TCP3 at UniProt or InterPro

Protein Sequence (399 amino acids)

>BPHYT_RS25380 acyl-CoA dehydrogenase (Burkholderia phytofirmans PsJN)
MDFQPDAGLEAFREQVRAFLREHLPRDLAGKPVGSVRSMRPDLVRWQKILNQQGWGAPYW
AKKDGGTGWSVLQRLVFDEECIAAGAPTQDGFAQKLLGPVLNEFASPEQKGEHVPLILAG
ERLWCQGFSEPGSGSDLASLRTRAERDGDHYIVNGQKIWTSYAHESDWIFLLVRTDTEVK
KQAGISFLLVDMKTPGITVRPIRSIDDCHHLNETFFDNVRVPVANRVGAEGAGWTITKFL
LNNEHASAADLPILRRYLMQLRTLAATQRVGCEPLIAQPAFALRLARLEAEVSAVATMVK
RVAAMEQDHSPAAHAMGSILKVRGTELQQRISELMVEALGDYGAVAYPEPHDTCEAEPLP
HQDVARGLANEMFFRRASTIYGGTSEVQRGIIAKMLFQL