Protein Info for BPHYT_RS25240 in Burkholderia phytofirmans PsJN

Annotation: choline-sulfatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 512 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR03417: choline-sulfatase" amino acids 5 to 508 (504 residues), 869.4 bits, see alignment E=4.4e-266 PF00884: Sulfatase" amino acids 6 to 350 (345 residues), 175.8 bits, see alignment E=2.7e-55 PF01663: Phosphodiest" amino acids 9 to 297 (289 residues), 43.9 bits, see alignment E=5.2e-15 PF16347: SGSH_C" amino acids 301 to 446 (146 residues), 54.1 bits, see alignment E=4.3e-18 PF12411: Choline_sulf_C" amino acids 456 to 507 (52 residues), 81.4 bits, see alignment 6.5e-27

Best Hits

KEGG orthology group: K01133, choline-sulfatase [EC: 3.1.6.6] (inferred from 100% identity to bpy:Bphyt_5075)

Predicted SEED Role

"Choline-sulfatase (EC 3.1.6.6)" in subsystem Choline Transport or Choline and Betaine Uptake and Betaine Biosynthesis (EC 3.1.6.6)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.1.6.6

Use Curated BLAST to search for 3.1.6.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TCL5 at UniProt or InterPro

Protein Sequence (512 amino acids)

>BPHYT_RS25240 choline-sulfatase (Burkholderia phytofirmans PsJN)
MLDSKKNILILMADQMTPFALAAYGHPLTKTPNLDRLAKQGVVFESAYCASPLCAPSRFS
FLSGKLPSAIGAYDNAAEFPSQTLTFAHYLRAEGYRTILSGKMHFCGADQLHGFEERLTT
DIYPADFGWTPDWDNFEARPTWYHNMSSVIDAGPCVRTNQLDFDDEVTFTARQKLFDIAR
ERHAGKDARPFCMVASLTHPHDPYAIPQKYWDMYRDEDIDMPAFRDSFEDADPHSKRLRH
VCETDRTPPTDQQIRNARRAYYGAISYVDDQFGAILEALDQAGLAQDTVIVVTSDHGEML
GERGLWYKMTFFEGGCRVPLIVHAPQQFDAHRVKDSVSHLDLVPTLVELARGEQPAVWPD
SLDGQSLVPHLFGKQGGHDEAIGEYLAEGAIAPIVMLRRGRFKFIHTPADPDQLYDVAAD
PLERENLAARSEYASQVAAFREEVAQRWNLAALHNEVLQSQRRRHFHFASTTQGTVASWD
WQPLVDASQRYMRNHIDLDTLEAMARFPAVAR