Protein Info for BPHYT_RS25230 in Burkholderia phytofirmans PsJN

Annotation: formyltetrahydrofolate deformylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00655: formyltetrahydrofolate deformylase
  • amino acids 11 to 290 (280 residues), 295.6 bits, E=2.2e-92
• PF00551: Formyl_trans_N
  • amino acids 96 to 272 (177 residues), 116.5 bits, E=6.2e-38

Best Hits

KEGG orthology group: K01433, formyltetrahydrofolate deformylase [EC: 3.5.1.10] (inferred from 100% identity to bpy:Bphyt_5073)

Predicted SEED Role

"Formyltetrahydrofolate deformylase (EC 3.5.1.10)" in subsystem One-carbon metabolism by tetrahydropterines (EC 3.5.1.10)

MetaCyc Pathways

• formaldehyde oxidation VII (THF pathway) (4/4 steps found)
• purine nucleobases degradation II (anaerobic) (16/24 steps found)
• folate transformations I (8/13 steps found)
• purine nucleobases degradation I (anaerobic) (6/15 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• One carbon pool by folate

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.10

Use Curated BLAST to search for 3.5.1.10

Sequence Analysis Tools

See B2TCL3 at UniProt or InterPro

Protein Sequence (291 amino acids)

>BPHYT_RS25230 formyltetrahydrofolate deformylase (Burkholderia phytofirmans PsJN)
MSVDSRPDQLVLTVACPSAAGQVAAVVGFLDRHHCYIDELTVFDDDLSERFFVRCVFHGA
DSQETLRVAALKREFEPIAERFRMTWAMHDVGTRPKVLIMVSKLEHCLADLLFRWRMGEL
KMDIVGIGSNHRDLEPLAQQHGLPFQHLPITADTKPQQEARLLDLFETSGAELMILARYM
QILSGETSRALAARAINIHHSFLPGFKGAKPYHQAHTRGVKLIGATAHFVTDDLDEGPII
EQVVERVDHSYSPERLLATGRDVECITLARAVKAFIERRVFINGDRTVVLQ