Protein Info for BPHYT_RS25170 in Burkholderia phytofirmans PsJN

Annotation: aldehyde dismutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 TIGR02819: formaldehyde dehydrogenase, glutathione-independent" amino acids 2 to 396 (395 residues), 769.4 bits, see alignment E=2.8e-236 PF08240: ADH_N" amino acids 35 to 144 (110 residues), 93.9 bits, see alignment E=8.5e-31 PF01262: AlaDh_PNT_C" amino acids 178 to 243 (66 residues), 27.9 bits, see alignment E=2.3e-10 PF00107: ADH_zinc_N" amino acids 197 to 264 (68 residues), 37.3 bits, see alignment E=3.7e-13

Best Hits

Swiss-Prot: 80% identical to FADH_PSEAE: Glutathione-independent formaldehyde dehydrogenase (fdhA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00148, glutathione-independent formaldehyde dehydrogenase [EC: 1.2.1.46] (inferred from 100% identity to bpy:Bphyt_5061)

Predicted SEED Role

"Threonine dehydrogenase and related Zn-dependent dehydrogenases" in subsystem Threonine degradation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.46

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TCK1 at UniProt or InterPro

Protein Sequence (399 amino acids)

>BPHYT_RS25170 aldehyde dismutase (Burkholderia phytofirmans PsJN)
MSSNRGVVYLGQGKVEVQSIDFPKMVDPRGRSIGHGVILKVVSTNICGSDQHMVRGRTTA
EVGLVLGHEITGEVIEVGRDVETLKVGDLVSVPFNVACGRCPTCKAQHTGVCLNVNPSRA
GGAYGYVDMGGWIGGQAEYVLVPYADFNLLKFPDHAQAMAKIRDLTCLSDILPTGYHGAV
MAGVKPGATVYIAGAGPVGMAAAASARLLGAACTIVGDMNEERLAHARKMGFQTIDLSKD
ATLGEQIEQILGKPEVDCAVDCVGFEAHGHGSSGSHEEAPATVLNSLMEITRAAGAIGIP
GLYVTDDPGAADAAARKGSLSIRFGLGWAKSHSFHTGQTPVMKYNHNLMQAILWDRLPIA
DIVNVTVVSLDQAPDGYRRFDGGAPKKFVIDPHGLLKAA