Protein Info for BPHYT_RS25120 in Burkholderia phytofirmans PsJN

Annotation: sarcosine oxidase subunit gamma

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04268: SoxG
  • amino acids 60 to 213 (154 residues), 80 bits, E=1.1e-26

Best Hits

KEGG orthology group: K00305, sarcosine oxidase, subunit gamma [EC: 1.5.3.1] (inferred from 100% identity to bpy:Bphyt_5051)

Predicted SEED Role

"Sarcosine oxidase gamma subunit (EC 1.5.3.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (EC 1.5.3.1)

MetaCyc Pathways

• glycine betaine degradation I (6/8 steps found)
• creatinine degradation II (2/5 steps found)
• creatinine degradation I (1/4 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.5.3.1

Use Curated BLAST to search for 1.5.3.1

Sequence Analysis Tools

See B2TCJ1 at UniProt or InterPro

Protein Sequence (218 amino acids)

>BPHYT_RS25120 sarcosine oxidase subunit gamma (Burkholderia phytofirmans PsJN)
MWNETRGTASVVDRAVGKQTGVWQESPLVGTDALLKKHQATANAAFRLNERPFLELVNVR
GDTRDAAFVRAFERVLGCRPPEKANTVARGNGYDVMWLGPDEWLVRSATAHDATRTAPLQ
AKLGAAFAGVFASAVDIGSGYTVLEISGTRTREVLSRGCPLDLHPKLFGEGQCAQSHYFK
ASMTLLPTGASSFDIVVRRSFADYFVKMMLDAAEPLMS