Protein Info for BPHYT_RS25095 in Burkholderia phytofirmans PsJN

Annotation: AraC family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details PF01965: DJ-1_PfpI" amino acids 58 to 195 (138 residues), 41.1 bits, see alignment E=2.5e-14 PF00165: HTH_AraC" amino acids 244 to 283 (40 residues), 26.7 bits, see alignment 7e-10 amino acids 298 to 334 (37 residues), 30.1 bits, see alignment 6.2e-11 PF12833: HTH_18" amino acids 257 to 336 (80 residues), 88.5 bits, see alignment E=4.5e-29

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_5046)

Predicted SEED Role

"Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TCI6 at UniProt or InterPro

Protein Sequence (360 amino acids)

>BPHYT_RS25095 AraC family transcriptional regulator (Burkholderia phytofirmans PsJN)
MNSAEPLPPQSIDGTSKQRIRFGIILLPNFTLTAFSGFVDLLRLSADEGDFSKPVRCSWS
VIGETLAPVRASCGIQITPWETFDTAEPFDYVVVVGGLLHSGPAANDATLAFIRRAAATD
ATLVGMCTGVFSLMRAGVLDGYRICVSWFHYWDFIERFPSVNEEALIADRLFVIDRRRIT
CSGGRASIDVAAAILLRHFETATVQKALRILLVDDMQKGNAPQPHPPGLAPATHPKVKRA
ILLMEQHVGRSLSLDELAGKLDLSPRQLERLFKAETGKAPQAYAKQVRLRTAAWLLTSSD
KTVADIASSCGFSDASHLGREFRKQFGLPPMMYREQRGTAAEAEDSGDYDETFPGRAQAI