Protein Info for BPHYT_RS25070 in Burkholderia phytofirmans PsJN

Annotation: choline ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 transmembrane" amino acids 42 to 61 (20 residues), see Phobius details amino acids 67 to 85 (19 residues), see Phobius details amino acids 91 to 114 (24 residues), see Phobius details amino acids 135 to 162 (28 residues), see Phobius details amino acids 214 to 234 (21 residues), see Phobius details amino acids 246 to 263 (18 residues), see Phobius details TIGR03416: choline ABC transporter, permease protein" amino acids 3 to 267 (265 residues), 385.4 bits, see alignment E=7.3e-120 PF00528: BPD_transp_1" amino acids 106 to 263 (158 residues), 96 bits, see alignment E=1.2e-31

Best Hits

Swiss-Prot: 50% identical to OPUAB_BACSU: Glycine betaine transport system permease protein OpuAB (opuAB) from Bacillus subtilis (strain 168)

KEGG orthology group: K02001, glycine betaine/proline transport system permease protein (inferred from 100% identity to bpy:Bphyt_5041)

Predicted SEED Role

"L-proline glycine betaine ABC transport system permease protein ProW (TC 3.A.1.12.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TCI1 at UniProt or InterPro

Protein Sequence (300 amino acids)

>BPHYT_RS25070 choline ABC transporter permease (Burkholderia phytofirmans PsJN)
MSEVIPLGAWVDHGVHYLLDHDAKTFDSIGKVIESFAAVIEHGLQAVPMWALMAFFVGIG
LWRVGWRFALFTLLAMLLIYGTGFWDQMVITLGLTLSSTLISLLLGVPLGIWTAKSRTVE
MIVRPVLDLMQTMPAFVYLIPAAMLFGLGRVPGILSTVIFAMPPAVRLTSLGIKHVNREI
VEAGQAFGCTPLQLLYKVQFPNALPSIMTGVNQTIMMALSMVIIASMVGAGGLGNDVLAS
IQRLDIGLGFESGLSVVMLAIILDRITESFGRSPGTARAPLLSGLRSVMKVRRQPAAQHG