Protein Info for BPHYT_RS25065 in Burkholderia phytofirmans PsJN

Annotation: glycine/betaine ABC transporter ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 TIGR01186: glycine betaine/L-proline transport ATP binding subunit" amino acids 38 to 385 (348 residues), 390.6 bits, see alignment E=3.5e-121 PF00005: ABC_tran" amino acids 45 to 193 (149 residues), 126 bits, see alignment E=8.8e-41

Best Hits

Swiss-Prot: 54% identical to OUSV_DICD3: Glycine betaine/choline transport system ATP-binding protein OusV (ousV) from Dickeya dadantii (strain 3937)

KEGG orthology group: K02000, glycine betaine/proline transport system ATP-binding protein [EC: 3.6.3.32] (inferred from 100% identity to bpy:Bphyt_5040)

Predicted SEED Role

"L-proline glycine betaine ABC transport system permease protein ProV (TC 3.A.1.12.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.32

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TCI0 at UniProt or InterPro

Protein Sequence (392 amino acids)

>BPHYT_RS25065 glycine/betaine ABC transporter ATPase (Burkholderia phytofirmans PsJN)
MNSPKVVVEGLCKVFGTNPKQAIGMLAGGATKEEVFARTGQIVGVHNVSFEVKEGEIFVL
MGLSGSGKSTLIRLINRLVEPTAGKVLIDGRDVASVPRSELTALRRKDMSMVFQSFALMP
QRTVLSNAAFGLEVAGVGRKEREKRAMTVLEQVGLAPFAQKLPAQLSGGMQQRVGLARAL
AVNPSLMIMDEAFSALDPLKRKEMQNVLLDLQREQQRTILFVSHDLEEAMRIGTRIAIME
GGRVVQVGTPQQIITNPADDYVRAFFEGIDTSRYLTAGDLMQTDAVPLMQHSPQIDASSV
AATLNGSADYAFVLDSERKIRGFVCRDAMGSASPQVNQIECIRRTTPLDDVVELVVASRA
PLPVVEADGSYCGSVNKTNVLNVLTRHRSSHV