Protein Info for BPHYT_RS25000 in Burkholderia phytofirmans PsJN

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 transmembrane" amino acids 21 to 45 (25 residues), see Phobius details amino acids 57 to 80 (24 residues), see Phobius details amino acids 89 to 107 (19 residues), see Phobius details amino acids 113 to 132 (20 residues), see Phobius details amino acids 144 to 167 (24 residues), see Phobius details amino acids 175 to 196 (22 residues), see Phobius details amino acids 232 to 251 (20 residues), see Phobius details amino acids 263 to 283 (21 residues), see Phobius details amino acids 290 to 309 (20 residues), see Phobius details amino acids 315 to 335 (21 residues), see Phobius details amino acids 348 to 370 (23 residues), see Phobius details amino acids 379 to 399 (21 residues), see Phobius details PF07690: MFS_1" amino acids 26 to 362 (337 residues), 68.7 bits, see alignment E=2.3e-23

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_5027)

Predicted SEED Role

"major facilitator superfamily MFS_1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TCH1 at UniProt or InterPro

Protein Sequence (414 amino acids)

>BPHYT_RS25000 MFS transporter (Burkholderia phytofirmans PsJN)
MKEASANPHRPSRAAAGKTRSLAILLLCQVGAMSVWFSSSAVVAIVRQAESLSAMQATLL
TSAVQAGFVAGTVTSALLSLADRFDPRRLFMLSALTAGAATACLVFLTPASPLAILLRLL
TGICMAGVYPVGMRLAATWAKGDLGLLIGLLVGALTFGSASPHLLAALGGSNWRAIYGIS
ACCALLAGVAILLCGVGPNMARATRIEWSALAGAWRNRALRLANLGYLGHMWELYAMWAW
LAVFLQASFAAAGMREPRAAAEWLTFGAVAAGALGAWLGGVLADRLGRTTVTIGAMAVSG
ACAALMGWLLGAPVWLVGCVALCWGISVIADSAQFSASIAELAEPASIGTLLTAQTCAGF
LLTLVSIHLVPDVVGLAGWRGAFSMLAVGPLLGCIAMARLRRLPDARRLAGGRR