Protein Info for BPHYT_RS24935 in Burkholderia phytofirmans PsJN

Annotation: cysteinyl-tRNA synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 TIGR00435: cysteine--tRNA ligase" amino acids 3 to 454 (452 residues), 395.6 bits, see alignment E=1.9e-122 PF01406: tRNA-synt_1e" amino acids 16 to 326 (311 residues), 304 bits, see alignment E=1.3e-94

Best Hits

Swiss-Prot: 74% identical to SYC1_BURL3: Cysteine--tRNA ligase 1 (cysS1) from Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)

KEGG orthology group: K01883, cysteinyl-tRNA synthetase [EC: 6.1.1.16] (inferred from 100% identity to bpy:Bphyt_5013)

Predicted SEED Role

"Cysteinyl-tRNA synthetase (EC 6.1.1.16)" in subsystem Conserved gene cluster possibly involved in RNA metabolism (EC 6.1.1.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.1.1.16

Use Curated BLAST to search for 6.1.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TCF3 at UniProt or InterPro

Protein Sequence (462 amino acids)

>BPHYT_RS24935 cysteinyl-tRNA synthetase (Burkholderia phytofirmans PsJN)
MPLRLYDTWTRTVREFTPIHPDHVGLYCCGPTVYDHAHIGNLRTYVFEDVLRRALVLNGY
NVRHVVNITDVGHLVSDADEGEDKMEKGSRRTGESAWAIAERYTAAFMNDWRALNLLEPA
LWCRATDHIAEQIDFIAELERNGFTYRTADGVYFDTSRQDDYGYLARLDVAGLQAGKRVA
PGEKQRATDFALWKFSPPGATRQMEWDSPWGRGFPGWHIECSAMSAKYLSPWFDIHCGGE
DHIPVHHSNEIAQTQARYGTRLANFWMHGHFLLLDAGKMSKSGGDFLRLQTLSERGNDPL
AYRYLCLSAHYRSSLRFSEAALDAAQAALDRLRRSYARWPQGGKPDAASVARFKAEVDHD
LNLPRALAVLWDVVRSDLPPATRRASVDCFDVVLGLGLADWKDVDTPELPAEIAALADQR
ERARAAKQWSEADRLRDVMTAAGWLVEDSAGGQVLRLRDQTE