Protein Info for BPHYT_RS24920 in Burkholderia phytofirmans PsJN

Annotation: cytochrome O ubiquinol oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 662 transmembrane" amino acids 16 to 38 (23 residues), see Phobius details amino acids 59 to 81 (23 residues), see Phobius details amino acids 102 to 126 (25 residues), see Phobius details amino acids 142 to 165 (24 residues), see Phobius details amino acids 188 to 212 (25 residues), see Phobius details amino acids 227 to 253 (27 residues), see Phobius details amino acids 286 to 304 (19 residues), see Phobius details amino acids 314 to 333 (20 residues), see Phobius details amino acids 345 to 367 (23 residues), see Phobius details amino acids 379 to 402 (24 residues), see Phobius details amino acids 414 to 435 (22 residues), see Phobius details amino acids 456 to 476 (21 residues), see Phobius details amino acids 493 to 517 (25 residues), see Phobius details amino acids 586 to 604 (19 residues), see Phobius details amino acids 610 to 630 (21 residues), see Phobius details TIGR02843: cytochrome o ubiquinol oxidase, subunit I" amino acids 2 to 647 (646 residues), 1159 bits, see alignment E=0 PF00115: COX1" amino acids 56 to 502 (447 residues), 495.7 bits, see alignment E=6.1e-153

Best Hits

Swiss-Prot: 72% identical to QOX1_ACEAC: Ubiquinol oxidase subunit 1 (cyaA) from Acetobacter aceti

KEGG orthology group: K02298, cytochrome o ubiquinol oxidase subunit I [EC: 1.10.3.-] (inferred from 100% identity to bpy:Bphyt_5010)

MetaCyc: 71% identical to cytochrome bo3 subunit 1 (Escherichia coli K-12 substr. MG1655)
RXN-21817 [EC: 7.1.1.3]

Predicted SEED Role

"Cytochrome O ubiquinol oxidase subunit I (EC 1.10.3.-)" in subsystem Terminal cytochrome O ubiquinol oxidase or Terminal cytochrome oxidases (EC 1.10.3.-)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 7.1.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TCF0 at UniProt or InterPro

Protein Sequence (662 amino acids)

>BPHYT_RS24920 cytochrome O ubiquinol oxidase (Burkholderia phytofirmans PsJN)
MFGKLSLDAIPYHEPIIMVTAAMIAIGGATLLGLITYFGKWRYLWTEWLTSVDHKKLGVM
YIVVALIMLFRGFADAIMMRLQQALAYANPGYLPPHHYDQVFTAHGVIMIFFMAMAFMIG
LMNIIVPLQIGARDVAFPFINSLSFWMTAVSAILINISLVIGEFAQTGWLAYPPLSELQF
SPGVGVDYYLWSLQLSGIGTLLTGVNFFATIVKMRAPGMTFMKMPVFTWTALCTNVLIMA
SFPILTVTLALLGLDRYLGMHFFTNDGGGNAMMYLNLIWAWGHPEVYILILPAFGIFSEV
VATFAKKPLFGYKTMVWATCAIMVLSFLVWLHHFFTMGSGADVNAFFGIATMVIAIPTGV
KVFNWLFTIYKGRLTFTPPILWTIGFMITFTIGGMTGVMMAIPGADFVLHNSLFLIAHFH
NVIIGGVLFGYLAGFNYWFPKAFGFKLNEKLGKASFWFWQIGFWVAFTPLYVLGFMGMTR
RINHYDNPLWHPWLILAAGGAALIAIGIALQVLQIVVSIRDRNLPRNRDLTGDPWNGHTL
EWAMSSPPPVYNFAIIPTVHKLDAFTDMKARKDTQAKPVYRDIHMPSNTSAGVIAGLFSL
VLGFAGVWHIWWLAIVGLVGAIGTVIVYSFQKNEGYYIPAATVAEIEEKRSGAGARVALE
VD