Protein Info for BPHYT_RS24825 in Burkholderia phytofirmans PsJN

Annotation: cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00708: cob(I)yrinic acid a,c-diamide adenosyltransferase
  • amino acids 28 to 200 (173 residues), 224.8 bits, E=3.3e-71
• PF02572: CobA_CobO_BtuR
  • amino acids 29 to 200 (172 residues), 224.7 bits, E=4.7e-71

Best Hits

KEGG orthology group: K00798, cob(I)alamin adenosyltransferase [EC: 2.5.1.17] (inferred from 100% identity to bpy:Bphyt_4997)

Predicted SEED Role

"Cob(I)alamin adenosyltransferase (EC 2.5.1.17)" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis (EC 2.5.1.17)

MetaCyc Pathways

• adenosylcobalamin biosynthesis II (aerobic) (30/33 steps found)
• adenosylcobalamin biosynthesis I (anaerobic) (30/36 steps found)
• superpathway of adenosylcobalamin salvage from cobinamide I (8/8 steps found)
• adenosylcobinamide-GDP biosynthesis from cobyrinate a,c-diamide (6/6 steps found)
• superpathway of adenosylcobalamin salvage from cobinamide II (8/9 steps found)
• adenosylcobalamin salvage from cobalamin (5/5 steps found)
• adenosylcobinamide-GDP salvage from cobinamide I (5/5 steps found)
• adenosylcobinamide-GDP salvage from cobinamide II (5/6 steps found)
• cobalamin salvage (eukaryotic) (4/8 steps found)

KEGG Metabolic Maps

• Porphyrin and chlorophyll metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.17

Use Curated BLAST to search for 2.5.1.17

Sequence Analysis Tools

See B2TCD7 at UniProt or InterPro

Protein Sequence (200 amino acids)

>BPHYT_RS24825 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase (Burkholderia phytofirmans PsJN)
MKTDPESHQRMTERRREGHEKKQANATVEKGLLIVNTGTGKGKTTAAFGMAVRVLGHGMR
LGVVQFIKGALHTSERDFLGAIANCDFVTMGDGYTWNTQNRDADIATARKGWDEARRMIE
SGEYQMVILDELNTVLKYEYLPLDEVLSVINARAPMLHVVVTGRHAPDALIEAADLVTEM
RIVKHPYREQGVKAQRGVEF