Protein Info for BPHYT_RS24805 in Burkholderia phytofirmans PsJN

Annotation: sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 829 transmembrane" amino acids 24 to 45 (22 residues), see Phobius details amino acids 316 to 338 (23 residues), see Phobius details amino acids 345 to 364 (20 residues), see Phobius details amino acids 369 to 388 (20 residues), see Phobius details PF05226: CHASE2" amino acids 35 to 324 (290 residues), 208.7 bits, see alignment E=1.2e-65 PF02518: HATPase_c" amino acids 699 to 815 (117 residues), 84.8 bits, see alignment E=5.7e-28

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_4993)

Predicted SEED Role

"Signal transduction histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TCD3 at UniProt or InterPro

Protein Sequence (829 amino acids)

>BPHYT_RS24805 sensor histidine kinase (Burkholderia phytofirmans PsJN)
MPTTPTLLSLDPRARLGRRAGRRFLIEWVGIGCLGIVVILLSSLGRLSASVDHLVYDRLL
SLRAQPLLRDIVVVEIDNASIAQLGRWPWPRSVHAKLLEQIAGAQPAAVIYDVLFTEANP
QDAELARAIALSPTYLPILLTAPDDSGRRVVVEPVAPLAHAAAGLGHINLEVDSDGIVRS
VARYEGDADSRWPQLMVPVAQAVEHGSLHLNGSQRGRALPAAETDPAADDGGEGRFLIPF
GPNAQNYTKLSFARVLAGDVPPEQLRGRIVLIGVTASGLYDRFATPVSGKLGPLPGVYIH
ANVLDTLLTGREIEPVYPWILFAVSLAPLAALLAGFLVLSPRRSLLLTGALCLLAAAGSA
ALLYGARLWMSPVPAIVGLVAVYPIWNWRRLEMTMAYLRGELQRLADEPHLLPETPQRRR
EFGGDVLEQHMALMAQAAQRVQDMKRFVWNSLDSMPEPILVSDVRGVVLIANHAAKAHFA
RLGAPLPEGRPMQAVLGGLTLVKTIDTDAASDAENSLLARAHWPAPLDPTRHEFAALMAH
GVEVRDVEERDHLLRYANCTNAQGETTGWIAGLVDVSALHAAERQREDALRLLSHDMRSP
QASILALVEIERARREPVLARGLLERIERYAQRALTLADDFVQLARAESQTYVLEPVSLA
ELLIDASDEVWPQAHAKRITLHTETGAADAADDDWICADRSLMTRALVNILNNAVKYSPP
DTRIVCSLASLTPKGVPAAKRVSCTIRDQGYGIPKDQQAGLFERFRRFHETERPEVGGAG
LGMAFVKTVVTRHGGDVEVASEPGQGTAFTICLPVLEDAQSGAAFTPRP