Protein Info for BPHYT_RS24755 in Burkholderia phytofirmans PsJN

Annotation: catalase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 signal peptide" amino acids 18 to 18 (1 residues), see Phobius details transmembrane" amino acids 19 to 38 (20 residues), see Phobius details PF00199: Catalase" amino acids 64 to 341 (278 residues), 94.1 bits, see alignment E=5.2e-31

Best Hits

Swiss-Prot: 40% identical to SRPA_SYNE7: Catalase-related peroxidase (srpA) from Synechococcus elongatus (strain PCC 7942)

KEGG orthology group: K00429, catalase [EC: 1.11.1.6] (inferred from 100% identity to bpy:Bphyt_4983)

Predicted SEED Role

"Catalase (EC 1.11.1.6)" in subsystem Oxidative stress or Photorespiration (oxidative C2 cycle) (EC 1.11.1.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.11.1.6

Use Curated BLAST to search for 1.11.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TCC3 at UniProt or InterPro

Protein Sequence (362 amino acids)

>BPHYT_RS24755 catalase (Burkholderia phytofirmans PsJN)
MAKPSVPNPAPACVPCRLAVIGAAVLALAGGFAYTAGWLTPARLTAPRIINTFEAVAGQH
PGYRRNHAKGLCVEGYFDGNGEGAALSSAAVFAAGRTPVTGRFAVPGGNPSAPDTSSPVR
SLALLFQLQNGEQWRTGMNSTPVFAVHTPEQFYQQLNAAKPDPATGKPDPAKLKAFYAAN
PETQPFQAWVKAHPPSSSLANAAYYSINAFRFTNGGGNTRAVRWAMVPETPYAPITDAEK
AEKNFLAADLDQRLQNGPLRWHLILTVAKPGDPTNDATLQWPDDRQHIDAGTLVIDHTTS
QANGTCRDINFDPTILPAGIAPSDDPLLAARSAAYALSYKRRTREEALHPALHQTQTNGD
HS