Protein Info for BPHYT_RS24675 in Burkholderia phytofirmans PsJN

Annotation: spermidine/putrescine ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details PF01547: SBP_bac_1" amino acids 53 to 258 (206 residues), 40.6 bits, see alignment E=4.9e-14 PF13531: SBP_bac_11" amino acids 54 to 245 (192 residues), 26.9 bits, see alignment E=6.1e-10 PF13343: SBP_bac_6" amino acids 123 to 317 (195 residues), 36 bits, see alignment E=8e-13

Best Hits

KEGG orthology group: K02055, putative spermidine/putrescine transport system substrate-binding protein (inferred from 99% identity to bxe:Bxe_B1682)

Predicted SEED Role

"ABC transporter, periplasmic spermidine putrescine-binding protein PotD (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TCA8 at UniProt or InterPro

Protein Sequence (364 amino acids)

>BPHYT_RS24675 spermidine/putrescine ABC transporter substrate-binding protein (Burkholderia phytofirmans PsJN)
MQEIKRGRRQAIKTLGAALAASTLPMPFINLRAQEHNFSGKTLRLLTWSDDTGAAALRNI
AATFTAKTGAKVIADRADGTSGMVAKVKAAGDRPTYDVITLAGVGAAGLGDAGLLMKPDL
DKLPNLKDVAPQYRTGANGFGVGYLLWSDGLIYNTSTVKTAPASYEALWDPKYAGRLFLP
PPEWAEAVDLAIIAAKMNGGSQQNIEPGFKKLMQLKDRVMTLGENPNQVADLFRTGSLDI
GGIYSPAFFPDQIRKPEYKMGVTYGMKEGFATQLMFTVIPKSHPGDSDLIHAFINHSLDA
GVQGRMAADVLNGPVNSKAVIPAESRAFVPSPQQIAEKAVLHDDKALAVVQPAWIKRYTE
IFAA