Protein Info for BPHYT_RS24665 in Burkholderia phytofirmans PsJN

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 transmembrane" amino acids 34 to 56 (23 residues), see Phobius details amino acids 100 to 121 (22 residues), see Phobius details amino acids 135 to 158 (24 residues), see Phobius details amino acids 164 to 180 (17 residues), see Phobius details amino acids 221 to 244 (24 residues), see Phobius details amino acids 264 to 284 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 116 to 284 (169 residues), 48.3 bits, see alignment E=5.3e-17

Best Hits

KEGG orthology group: K02053, putative spermidine/putrescine transport system permease protein (inferred from 100% identity to bpy:Bphyt_4966)

Predicted SEED Role

"ABC spermidine/putrescine transporter, inner membrane subunit"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TCA6 at UniProt or InterPro

Protein Sequence (295 amino acids)

>BPHYT_RS24665 ABC transporter permease (Burkholderia phytofirmans PsJN)
MSTPVQTAPSRMPGSPRSPRLAAVMPGQLGKATALLAAIVLFLAALPILTMITMSFSAAD
TLEFPPHAYGLHWYHAAWHSFVSPDASDTLSMGDALRTSLVVALSTMVIATLVSVPAAYA
LSRYRFRGKPAVEQLVALPLVYPLVMLGLSLLLVFNVLPVELGVFRLIIAHVILALPFTV
KNCAASVASIGPEFEEAACVMGASPGRALVDVILPLMRPGILAGMLFAFIISFNEFTVTF
FLYGIDTMTLPVWLYSRTVSSLDPTVFCFAVFIVAIDFALIWLLEKLIGDEGVAL