Protein Info for BPHYT_RS24660 in Burkholderia phytofirmans PsJN

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 PF00005: ABC_tran" amino acids 19 to 161 (143 residues), 141.5 bits, see alignment E=5.6e-45 TIGR01187: polyamine ABC transporter, ATP-binding protein" amino acids 35 to 315 (281 residues), 355.9 bits, see alignment E=9.2e-111 PF08402: TOBE_2" amino acids 275 to 348 (74 residues), 24.4 bits, see alignment E=5.2e-09

Best Hits

KEGG orthology group: K02052, putative spermidine/putrescine transport system ATP-binding protein (inferred from 100% identity to bpy:Bphyt_4965)

Predicted SEED Role

"Putrescine transport ATP-binding protein PotA (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TCA5 at UniProt or InterPro

Protein Sequence (357 amino acids)

>BPHYT_RS24660 ABC transporter ATP-binding protein (Burkholderia phytofirmans PsJN)
MTHLTLQAVTRRFGAAHAVDNVDLSVPDGKLVCFLGPSGCGKTTLLRMIAGLETPTSGSI
HFAGRDITRLPANQRDFGMVFQSLALFPHMTVAQNIAYPLKLRKTAKDQQTRRVAELLEL
IQLPHMANRPVTQLSGGQRQRVAIARAIASQPKLLLLDEPLSALDAKLREAMQVEIRLLQ
QRLGITTIMVTHDQREAMTMADEIVVMEKGRIAQVGKPLDIYRDPVSEFVADFIGLGNIL
PVTYDGAGGVSLPGGRRISVVQPARVPESSSDIRLLIRPEDVCVKAASDAAGPNRLLGTV
TFIRDVGASLEATIDCAGFTLTAATTPRETPGLALGMPVLAELPPHACKLIAARAAH