Protein Info for BPHYT_RS24650 in Burkholderia phytofirmans PsJN

Annotation: polar amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 transmembrane" amino acids 20 to 48 (29 residues), see Phobius details amino acids 69 to 87 (19 residues), see Phobius details amino acids 93 to 113 (21 residues), see Phobius details amino acids 137 to 165 (29 residues), see Phobius details amino acids 190 to 209 (20 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 16 to 111 (96 residues), 98.2 bits, see alignment E=1.6e-32 PF00528: BPD_transp_1" amino acids 40 to 214 (175 residues), 78 bits, see alignment E=3.9e-26

Best Hits

Swiss-Prot: 34% identical to GLNM_BACSU: Probable glutamine ABC transporter permease protein GlnM (glnM) from Bacillus subtilis (strain 168)

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 100% identity to bpy:Bphyt_4963)

Predicted SEED Role

"amino acid ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TCA3 at UniProt or InterPro

Protein Sequence (248 amino acids)

>BPHYT_RS24650 polar amino acid ABC transporter permease (Burkholderia phytofirmans PsJN)
MTYAFDFSGFGLYGGMLARGVAVTLGLTAVSTVLGGIVGIAGASVAVAGPKWARWVVASY
VELIRNTPFIVQLFFVFFGLPSLGIHIDEVQAAILAMTVNLGAYAIEIVRAGIDSISRGQ
IQAAQALGLHGRQVFRFIVLPQAIANVFPALLSQVLIVMLGSAVVSQISVPDLTYAANFI
QSRNFRSFESYLIITATYLVLSIALRQILNRLGRGLFAGRVARGNESAPRNWRNRLMWRG
ARTLPTER