Protein Info for BPHYT_RS24640 in Burkholderia phytofirmans PsJN

Annotation: alcohol dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF00034: Cytochrom_C" amino acids 32 to 131 (100 residues), 27.5 bits, see alignment E=6.9e-10 amino acids 190 to 288 (99 residues), 23.9 bits, see alignment E=8.5e-09 amino acids 317 to 401 (85 residues), 42.8 bits, see alignment E=1.1e-14 PF13442: Cytochrome_CBB3" amino acids 314 to 399 (86 residues), 34.8 bits, see alignment E=1.7e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_4961)

Predicted SEED Role

"Putative diheme cytochrome c-553" in subsystem Soluble cytochromes and functionally related electron carriers

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TCA1 at UniProt or InterPro

Protein Sequence (426 amino acids)

>BPHYT_RS24640 alcohol dehydrogenase (Burkholderia phytofirmans PsJN)
MKNTLKGFGAALCLTLPLFAQTPARAADQALVQRGAYLAKAGDCVACHTAPKGKPFAGGL
PMTTPMGQIYTTNITPDPQTGIGGYTEEDFARAMREGVAKDGHNLYPAMPYPSYAKVNDD
DMKALYAYFMSGVAPVQQANREPDIKWPLNMRWPLKFWNMVFLDKGVYQDKPGKDVAWNR
GAYLIQGLGHCGSCHTPRGIAFQEKALDESGSAFLTGGLLDGWFAANLTGEHNVGLGRWN
DQDLQAFLKTGANRHASAFGSMTSVINNSTQGLNDTDIAAMSTYLKSLPPAGGSGAPPYK
YDPQATKVSLNRPANDAGARVYTAYCMHCHGVDGRGFAPMLAPLSGNPNVLEKDPSSLIN
VTLNGTEDLVIGGIPAPYPMPKYAPVLNDQQIADVLTFVRAGWNNGAPAVTADDVAKLRK
STHAAR