Protein Info for BPHYT_RS24540 in Burkholderia phytofirmans PsJN

Annotation: DMSO reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 43 to 67 (25 residues), see Phobius details amino acids 88 to 108 (21 residues), see Phobius details amino acids 114 to 137 (24 residues), see Phobius details amino acids 149 to 171 (23 residues), see Phobius details amino acids 177 to 197 (21 residues), see Phobius details amino acids 252 to 271 (20 residues), see Phobius details amino acids 277 to 299 (23 residues), see Phobius details PF04976: DmsC" amino acids 4 to 214 (211 residues), 67.1 bits, see alignment E=9e-23

Best Hits

KEGG orthology group: K07308, anaerobic dimethyl sulfoxide reductase subunit C (DMSO reductase anchor subunit) (inferred from 100% identity to bpy:Bphyt_4942)

Predicted SEED Role

"Anaerobic dimethyl sulfoxide reductase chain C (EC 1.8.5.3)" (EC 1.8.5.3)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.8.5.3

Use Curated BLAST to search for 1.8.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TBZ9 at UniProt or InterPro

Protein Sequence (316 amino acids)

>BPHYT_RS24540 DMSO reductase (Burkholderia phytofirmans PsJN)
MNPAFSVVFLTTLSGAAQGLLIALVGVETAAHLGLLASPSGAFYIAGAGVSVVLGGLGLI
ASFFHLGHPERAWRAIAMWRTSWLSRECLCLPAFLACAFFYGVAHWFGSPWSLAIGWLGV
LASAMLFVCTAMIYACLRFLQEWATPLTLVNFTLLGCASGFTLATALSAWFAPEWTVGLA
VCACVLTLAGCASRSASLMRNARLRPKSTVQSATGIHNPKLVQVSRGFTAGAFNLREFFH
GKSAGTLRNVKWGFLATAFVAPVLLLALGAGLHSIGVSLGLLAAACLVQYAGLVAERWFF
FAEAKHPQNLYYARVG