Protein Info for BPHYT_RS24485 in Burkholderia phytofirmans PsJN

Annotation: thioredoxin reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 60 to 81 (22 residues), see Phobius details amino acids 125 to 145 (21 residues), see Phobius details amino acids 166 to 189 (24 residues), see Phobius details PF01292: Ni_hydr_CYTB" amino acids 10 to 198 (189 residues), 91 bits, see alignment E=4.2e-30

Best Hits

Swiss-Prot: 51% identical to YEDZ1_AZOOP: Putative protein-methionine-sulfoxide reductase subunit YedZ1 (yedZ1) from Azospira oryzae (strain ATCC BAA-33 / DSM 13638 / PS)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_4931)

Predicted SEED Role

"Thiosulfate reductase cytochrome B subunit (membrane anchoring protein)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TC75 at UniProt or InterPro

Protein Sequence (211 amino acids)

>BPHYT_RS24485 thioredoxin reductase (Burkholderia phytofirmans PsJN)
MPESKSRLLVHPLVVRITHWINAFAMVCMVMSGWAIYNASPFFPFRFPVWATVGGWLGGS
IAWHFAAMWLLCANGLLYFAYGLGRGHFRRKLLPVHPRDVVHDASLALRFNLPHDSGKYN
AVQRALYLLVLCLGVLLVASGLSIWKPVQFSWLTALFGGFDFARRVHFIAMAGVVGFVVV
HLALVLLVPRTLLPMLTGRARLHSAHERSEA