Protein Info for BPHYT_RS24375 in Burkholderia phytofirmans PsJN

Annotation: type VI secretion system protein ImpK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 transmembrane" amino acids 207 to 229 (23 residues), see Phobius details TIGR03349: type IV/VI secretion system protein, DotU family" amino acids 30 to 235 (206 residues), 196.6 bits, see alignment E=2.2e-62 PF09850: DotU" amino acids 31 to 229 (199 residues), 202 bits, see alignment E=4.4e-64

Best Hits

KEGG orthology group: K11892, type VI secretion system protein ImpK (inferred from 100% identity to bpy:Bphyt_4909)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TC53 at UniProt or InterPro

Protein Sequence (260 amino acids)

>BPHYT_RS24375 type VI secretion system protein ImpK (Burkholderia phytofirmans PsJN)
MSYAPSLFGGSSTPTATPAPITEPTYQVRSLLDLLYDGFFMLFLLKNGREPGDAQEFSQR
IQQFLGDFERGAKKLNASADDVYASKFAFCAAIDESVLSSTFRIRTEWERRPLQLVLFGE
QLAGEKFFQYLEECRAQGAARLQSLEVFHMCLLLGFQGKYLLEGPEKLAYLTARIGDEIA
HMKGKRAPFAPHWPLPDQVAHRLKREVPLWSIGAVFALVGLLAYLGLNTYLRDQTLRSLA
PYSQVVKLGPQSATLTISLP